MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli. Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli. J. Cell Biol. (0021-9525) 2000 Charroux B., Pellizzoni L., Perkinson RA., Yong J., Shevchenko A., Mann M., Dreyfuss G. no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Charroux B., Pellizzoni L., Perkinson RA., Yong J., Shevchenko A., Mann M., Dreyfuss G. no J. Cell Biol. (0021-9525) 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli. Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli. J. Cell Biol. (0021-9525) 2000 Charroux B., Pellizzoni L., Perkinson RA., Yong J., Shevchenko A., Mann M., Dreyfuss G. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Charroux B., Pellizzoni L., Perkinson RA., Yong J., Shevchenko A., Mann M., Dreyfuss G. no J. Cell Biol. (0021-9525) 2000 Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli. Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli. J. Cell Biol. (0021-9525) 2000 Charroux B., Pellizzoni L., Perkinson RA., Yong J., Shevchenko A., Mann M., Dreyfuss G. no in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Charroux B., Pellizzoni L., Perkinson RA., Yong J., Shevchenko A., Mann M., Dreyfuss G. no J. Cell Biol. (0021-9525) 2000 ddx20_human Probable ATP-dependent RNA helicase DDX20 DDX20 DP103 GEMIN3 DEAD box protein 20 DEAD box protein DP 103 Component of gems 3 Gemin-3 protein protein human Homo sapiens Human MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDPTFVRLNSSDPSLIGLKQYYKVVNSYPLAHKVFEEKTQHLQELFSRIPFNQALVFSNLHSRAQHLADILSSKGFPAECISGNMNQNQRLDAMAKLKHFHCRVLISTDLTSRGIDAEKVNLVVNLDVPLDWETYMHRIGRAGRFGTLGLTVTYCCRGEEENMMMRIAQKCNINLLPLPDPIPSGLMEECVDWDVEVKAAVHTYGIASVPNQPLKKQIQKIERTLQIQKAHGDHMASSRNNSVSGLSVKSKNNTKQKLPVKSHSECGIIEKATSPKELGCDRQSEEQMKNSVQTPVENSTNSQHQVKEALPVSLPQIPCLSSFKIHQPYTLTFAELVEDYEHYIKEGLEKPVEIIRHYTGPGDQTVNPQNGFVRNKVIEQRVPVLASSSQSGDSESDSDSYSSRTSSQSKGNKSYLEGSSDNQLKDSESTPVDDRISLEQPPNGSDTPNPEKYQESPGIQMKTRLKEGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ DIP protein Q9UHI6 original sequence version: 120 76712F014B2A0CF2 gemi4_human Gem-associated protein 4 GEMIN4 Component of gems 4 p97 protein protein human Homo sapiens Human MDLGPLNICEEMTILHGGFLLAEQLFHPKALAELTKSDWERVGRPIVEALREISSAAAHSQPFAWKKKALIIIWAKVLQPHPVTPSDTETRWQEDLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAMAHKYLPALDEFPHPPKRLRSDPDACPTMPLLAMLLRGLTQIQSRILGPGRKCCALANLADMLTVFALTEDDPQEVSATVYLDKLATVISVWNSDTQNPYHQQALAEKVKEAERDVSLTSLAKLPSETIFVGCEFLHHLLREWGEELQAVLRSSQGTSYDSYRLCDSLTSFSQNATLYLNRTSLSKEDRQVVSELAECVRDFLRKTSTVLKNRALEDITASIAMAVIQQKMDRHMEVCYIFASEKKWAFSDEWVACLGSNRALFRQPDLVLRLLETVIDVSTADRAIPESQIRQVIHLILECYADLSLPGKNKVLAGILRSWGRKGLSEKLLAYVEGFQEDLNTTFNQLTQSASEQGLAKAVASVARLVIVHPEVTVKKMCSLAVVNLGTHKFLAQILTAFPALRFVEEQGPNSSATFMVSCLKETVWMKFSTPKEEKQFLELLNCLMSPVKPQGIPVAALLEPDEVLKEFVLPFLRLDVEEVDLSLRIFIQTLEANACREEYWLQTCSPFPLLFSLCQLLDRFSKYWQLPKEKRCLSLDRKDLAIHILELLCEIVSANAETFSPDVWIKSLSWLHRKLEQLDWTVGLRLKSFFEGHFKCEVPATLFEICKLSEDEWTSQAHPGYGAGTGLLAWMECCCVSSGISERMLSLLVVDVGNPEEVRLFSKGFLVALVQVMPWCSPQEWQRLHQLTRRLLEKQLLHVPYSLEYIQFVPLLNLKPFAQELQLSVLFLRTFQFLCSHSCRDWLPLEGWNHVVKLLCGSLTRLLDSVRAIQAAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSSF ACEC60EC19EF5081 ruxe_chick Small nuclear ribonucleoprotein E SNRPE Sm protein E protein protein chick Gallus gallus (Chicken) Chicken MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN Associated with snRNP U1, U2, U4/U6 and U5 mint 7D8881CE1F4FA2FD smd2_mouse Small nuclear ribonucleoprotein Sm D2 Snrpd2 snRNP core protein D2 protein protein mouse Mus musculus Mouse MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK D986059D82B7E045 smd3_mouse Small nuclear ribonucleoprotein Sm D3 Snrpd3 snRNP core protein D3 protein protein mouse Mus musculus Mouse MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR 59A6E78E860AA3E0 rsmb_human Small nuclear ribonucleoprotein-associated proteins B and B' Sm protein B/B' SNRPB COD SNRPB1 protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP DIP protein P14678 original sequence version: 150 DIP protein P14678 original sequence version: 131 DIP protein P14678 original sequence version: 186 F2E1D5E11A601170 smd1_mouse Small nuclear ribonucleoprotein Sm D1 Snrpd1 snRNP core protein D1 Sm-D autoantigen protein protein mouse Mus musculus Mouse MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA mint 0C81C94BF98E0810 gemin4-snrpd1 1 10 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association mint gemin4-snrpd3 1 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint gemin4-ddx20-1 1 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 4 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint gemin4-snrpe 1 6 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint gemin4-snrpd2 1 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association mint gemin4-snrpb 1 9 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 5 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association homomint mint gemin4-snrpd2-1 2 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 7 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction mint gemin4-snrpe-1 2 6 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint gemin4-snrpb-1 2 9 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint gemin4-ddx20-2 2 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint gemin4-snrpd1-1 2 10 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction mint gemin4-snrpd3-1 2 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 8 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint gemin4-ddx20-3 3 5 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 4 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint