MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Maskin is a CPEB-associated factor that transiently interacts with elF-4E. Maskin is a CPEB-associated factor that transiently interacts with elF-4E. Mol. Cell (1097-2765) 1999 Stebbins-Boaz B., Cao Q., de Moor CH., Mendez R., Richter JD. xenla Xenopus laevis (African clawed frog) African clawed frog pull down pull down western blot western blot Immuno blot Immuno blot Stebbins-Boaz B., Cao Q., de Moor CH., Mendez R., Richter JD. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 1999 Maskin is a CPEB-associated factor that transiently interacts with elF-4E. Maskin is a CPEB-associated factor that transiently interacts with elF-4E. Mol. Cell (1097-2765) 1999 Stebbins-Boaz B., Cao Q., de Moor CH., Mendez R., Richter JD. xenla Xenopus laevis (African clawed frog) African clawed frog coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Stebbins-Boaz B., Cao Q., de Moor CH., Mendez R., Richter JD. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 1999 Maskin is a CPEB-associated factor that transiently interacts with elF-4E. Maskin is a CPEB-associated factor that transiently interacts with elF-4E. Mol. Cell (1097-2765) 1999 Stebbins-Boaz B., Cao Q., de Moor CH., Mendez R., Richter JD. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast beta galactosidase beta galactosidase complementation beta galactosidase predetermined predetermined participant predetermined Stebbins-Boaz B., Cao Q., de Moor CH., Mendez R., Richter JD. Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 1999 if4e_xenla Eukaryotic translation initiation factor 4E mRNA cap-binding protein eIF-4F 25 kDa subunit eif4e protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAAVEPENTNPQSTEEEKETGQEIVSPDQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEHSDDVCGAVVNVRAKGDKIAIWTTEFENKDAVTHIGRVYKERLGLPAKVVIGYQSHADTATKSGSTTKNRFVV DIP protein P48597 original sequence version: 42 E9412DFF235AE9E8 tacc3_xenla Transforming acidic coiled-coil-containing protein 3 Cytoplasmic polyadenylation element-binding protein-associated factor Maskin tacc3 maskin protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSLQIINDENAGNDITAEKFDLLLNPQTTGRPSILRPSQKDNLPPKPALKSTKVTFQTPMRDPQTLRIMTPSVANKPENVFLLEDCTQALEQLHLSLPSSCGPNPVEINVSVSNNQPDSEELPVRTTGAYSIDFDNFDDINPFKSKTQMLNSPIKADLPSLTENIETTTPVVPADEASKQMVSLNLSAANLDSPVTVQFSSESGSIGVSEKTALDDTLPLSESGIKDLQGLNASSNNIEEPVPLDKDICSNNEKDDATMADSTCEGTSDAHTSSNNIEEPVTLDKDICSSNEKDNAAVADSTCEGTSDAQSPLPIPKSSYSFDPDQFDMMNPFKTGGSKLQNSPAGKKQTPPSADLNTAKTEPVKLEFNFGDGDVSERKPPPKKLGKRPLLKTAAKKPSPKPEIASEKQEQQTAKPSEDEAIVPKASYKFDWEKFDDPNFNPFGCGGSKISSSPKGQKIANEQPSACTQGSKPEAECTASDMAPAENADEKDHGEIEPSQDSGAAEDRSQAEDQSVALSKVEVPHEQTTDCSPVENETQPEVSLINEEPSQKEVEHTSSDMTPPEINGTDSEFKLATEADFLLAADMDFKPASEIFSEGFRQPVEIDYLENFGTNSFKESVLRKQSLYLKFDPLLRESPKKSAAGINLLPSVPLKCSSDLFGAIPEANFPLIPSIENEEKPKGLDLLGTFTVADTALLIVDAPSSVAVPNPFLSTSDAIVEMLKYSQKDMDAAIEAVRLEVQEKDLEVLEWKTKHEKLYLEYVEMGKIIAEFEGTITQILEDSQRQKETAKLELNKVLQEKQQVQVDLNSMETSFSELFKRLEKQKEALEGYRKNEEALKKCVEDYLVRIKKEEQRYQALKAHAEEKLNRANEEIAHVRSKAKSEATALQATLRKEQMKIQSLERSLEQKSKENDELTKICDDFILKMEKI DIP protein Q9PTG8 original sequence version: 30 B0BF1F2AA4901439 cpe1a_xenla Cytoplasmic polyadenylation element-binding protein 1-A 58 kDa CPE-binding protein cpeb1-a cpeb protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAFPLKDDLGRAKDCWGCPSDTPALSTCSNADIFRRINAMLDNSLDFTGVCTTPNTKGKCEHLQDYQDTEGPAASRMLFSTSHEPLPRGLPDTNDLCLGLQSLSLTGWDRPWSTQDSEAGGHSSTPTAAQSVFSMLNSPMGKPSPLGFLTFDPIGSDLMEKYPTPLLRSSRLDSRSILDSRSSSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLPLGGGVSRDPLKLGIGSRLDQDHAALAAATVSPLGITKGWPSTSVWPSWDLLDSAEDPFSIEREARLHRQAAAVNEATCTWSGQLPPRNYKNPVYSCKVFLGGVPWDITETGLINTFRVFGALSVEWPGKDGKHPRCPPKGNMPKGYVYLVFESEKSVRALLQACSQDLLSQDGLSEHYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRLDPSKTVFVGALHGMLNAEALASIMNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLKAVSAAFVEIKTAKFTKKVQIDPYLEDSVCQVCNAQPGPFFCRDQVCFKYFCRSCWHWQHSMEILRHHRPLMRNQKSRDSS EF812949F5B4DE54 EF812949F5B4DE54 7-methyl-gtp 7-methyl-GTP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) maskin-cpeb-ip 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association maskin-cpeb-eif4e 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association maskin-eif4e-cpeb 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 7m GTP linked to sepharose (Cap column) used as bait maskin-eif4e 3 4 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association maskin-cpeb 3 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association