MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. J. Cell Biol. (0021-9525) 1999 Stabler SM., Ostrowski LL., Janicki SM., Monteiro MJ. no human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Stabler SM., Ostrowski LL., Janicki SM., Monteiro MJ. no J. Cell Biol. (0021-9525) 1999 A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. J. Cell Biol. (0021-9525) 1999 Stabler SM., Ostrowski LL., Janicki SM., Monteiro MJ. no in vivo in vivo 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Stabler SM., Ostrowski LL., Janicki SM., Monteiro MJ. no J. Cell Biol. (0021-9525) 1999 A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. A myristoylated calcium-binding protein that preferentially interacts with the Alzheimer's disease presenilin 2 protein. J. Cell Biol. (0021-9525) 1999 Stabler SM., Ostrowski LL., Janicki SM., Monteiro MJ. no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Stabler SM., Ostrowski LL., Janicki SM., Monteiro MJ. no J. Cell Biol. (0021-9525) 1999 psn2_human Presenilin-2 PSEN2 AD4 PS2 PSNL2 STM2 STM-2 E5-1 AD3LP AD5 protein protein human Homo sapiens Human MLTFMASDSEEEVCDERTSLMSAESPTPRSCQEGRQGPEDGENTAQWRSQENEEDGEEDPDRYVCSGVPGRPPGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLLFLFTYIYLGEVLKTYNVAMDYPTLLLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMALVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLTGYPGEELEEEEERGVKLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISITFGLIFYFSTDNLVRPFMDTLASHQLYI A927EEC623468116 cib1_human Calcium and integrin-binding protein 1 Calmyrin DNA-PKcs-interacting protein Kinase-interacting protein SNK-interacting protein 2-28 CIB1 CIB KIP PRKDCIP Calcium- and integrin-binding protein protein protein human Homo sapiens Human MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILSLPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL DIP protein Q99828 original sequence version: 104 9AA19A0DE7AA1E05 psen2-cib1 3 5 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 4 unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-368846: original sequence: 270-320 : PKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPY Stoichiometry: 1.0 direct interaction direct interaction homomint mint psen2-cib1-1 2 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-368876: original sequence: 270-320 : PKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPY Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association homomint mint cib1-psen2 1 Calmyrin 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 PS2 4 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-368858: original sequence: 270-320 : PKGPLRMLVETAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPY Stoichiometry: 1.0 colocalization colocalization F6 homomint mint