MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol. Cell (1097-2765) 1999 Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library mouse-fdcp-1 Mus musculus bone marrow fdcp-1 long-term bone marrow culture of mice anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The source organism of the Bim sequences is not stated but assumed to be mouse as in previous experiments in the same paper. no HeLa cell library Mol. Cell (1097-2765) 1999 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol. Cell (1097-2765) 1999 Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The source organism of bim sequences is not stated but assumed to be mouse as in previous experiments in the same paper. no HeLa cell library Mol. Cell (1097-2765) 1999 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol. Cell (1097-2765) 1999 Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library Mol. Cell (1097-2765) 1999 The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex. Mol. Cell (1097-2765) 1999 Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis HeLa cell library human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Puthalakath H., Huang DC., O'Reilly LA., King SM., Strasser A. Apoptosis - Interactions involving proteins with a function related to apoptosis The antibodies used in the westernblot do not allow identification of the interaction partner splice variants. no HeLa cell library Mol. Cell (1097-2765) 1999 b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 o54918-2 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH B127B40A190DA923 o54918-1 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH 531C176E5F1AC9AA b2cl1_human Bcl-2-like protein 1 BCL2L1 BCL2L BCLX Apoptosis regulator Bcl-X protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK E09D3CDD851AE9BE dlrb1_human Dynein light chain roadblock-type 1 DYNLRB1 BITH DNLC2A HSPC162 Dynein light chain 2A, cytoplasmic Dynein-associated protein Km23 Bithoraxoid-like protein DNCL2A ROBLD1 Roadblock domain-containing protein 1 protein protein human Homo sapiens Human MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE AAE1EFCD372897B3 dlrb2_mouse Dynein light chain roadblock-type 2 Dynein light chain 2B, cytoplasmic Dynlrb2 Dnlc2b Dncl2b protein protein mouse Mus musculus Mouse MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE 5C446A9D0E815775 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB biml-dncl2a-1 3 6 unspecified role unspecified role bait bait region required binding region binding-associated region binding region mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain O54918-2:p.Ser53Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S P Wed May 02 15:22:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53pro' Tue Jun 30 17:55:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Pro' O54918-2:p.Thr54Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:55:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala' Tue Jun 30 18:50:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr54Ala' O54918-2:p.[Thr54Ala;Asn65Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain N S Fri Jul 22 11:15:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala-asn65ser' Wed May 02 19:52:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala,asn65ser' Tue Jun 30 19:02:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr54Ala;Asn65Ser]' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 9 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association biml-dncl2a-2 2 6 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association dncl2a-biml-1 2 6 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association bimel-dncl2a-1 2 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association biml-dncl2a-3 1 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O54918-2:p.Asp51Gly mutation mutation certain certain sequence position certain certain certain sequence position certain D G Wed May 02 18:41:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp51gly' Tue Jun 30 19:46:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp51Gly' O54918-2:p.Ser53Pro mutation mutation certain certain sequence position certain certain certain sequence position certain S P Wed May 02 18:01:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53pro' Tue Jun 30 19:25:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Pro' O54918-2:p.Thr54Ala mutation mutation certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:39:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala' Tue Jun 30 17:54:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr54Ala' O54918-2:p.[Thr54Ala;Asn65Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain N S Fri Jul 22 10:54:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala-asn65ser' Wed May 02 14:25:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr54ala,asn65ser' Tue Jun 30 20:08:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr54Ala;Asn65Ser]' association association Biml appear to be the bridging molecule as dynein can only be immunoprecipitade with Bcl-2 when Biml is expressed. When the biml mutants are expressed, cells die much faster after the induction of apopotosis (by irradiation or cytochine deprivation) compared to cells tranfected with wild type biml. bcl2-dncl2a-1 1 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Biml appear to be the bridging molecule as dynein can only be immunoprecipitade with Bcl-2 when Biml is expressed bclxl-biml-1 2 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey ee-epitope tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey association association bim-dncl2a-1 4 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association