IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I 2020 imex curation Zhang Y, Zhang J, Chen Y, Luo B, Yuan Y, Huang F, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Pan T, Zhang X, Li Y, Li R, Huang W, Xiao F, Zhang H Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Fig. S2A is meant to show OEF8A-HA interacting proteins found by MS/MS - but they only show "The top 20 significant enrichments of the gene ontology (GO) biological process terms.". Email sent to authors 27/5/20 requesting proteins identified - "high -confidence" ones! no reply expected....none received 8/6/20 10.1101/2020.05.24.111823 zhangh92@mail.sysu.edu.cn,zhangyw57@mail.sysu.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Jane Doe Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Fig. S2A is meant to show OEF8A-HA interacting proteins found by MS/MS - but they only show "The top 20 significant enrichments of the gene ontology (GO) biological process terms.". Email sent to authors 27/5/20 requesting proteins identified - "high -confidence" ones! no reply expected....none received 8/6/20 Cells were cross-linked using DSP (dithiobis (succinimidyl propionate)) followed by Anti-HA IP. zhangh92@mail.sysu.edu.cn,zhangyw57@mail.sysu.edu.cn Accepted 2020-JUN-09 AT 07:51 BST AT 07:51 BST by KALPANAP 2020 imex curation The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I 2020 imex curation Zhang Y, Zhang J, Chen Y, Luo B, Yuan Y, Huang F, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Pan T, Zhang X, Li Y, Li R, Huang W, Xiao F, Zhang H Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Fig. S2A is meant to show OEF8A-HA interacting proteins found by MS/MS - but they only show "The top 20 significant enrichments of the gene ontology (GO) biological process terms.". Email sent to authors 27/5/20 requesting proteins identified - "high -confidence" ones! no reply expected....none received 8/6/20 10.1101/2020.05.24.111823 zhangh92@mail.sysu.edu.cn,zhangyw57@mail.sysu.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Jane Doe Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Fig. S2A is meant to show OEF8A-HA interacting proteins found by MS/MS - but they only show "The top 20 significant enrichments of the gene ontology (GO) biological process terms.". Email sent to authors 27/5/20 requesting proteins identified - "high -confidence" ones! no reply expected....none received 8/6/20 zhangh92@mail.sysu.edu.cn,zhangyw57@mail.sysu.edu.cn Accepted 2020-JUN-09 AT 07:51 BST AT 07:51 BST by KALPANAP 2020 imex curation The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I 2020 imex curation Zhang Y, Zhang J, Chen Y, Luo B, Yuan Y, Huang F, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Pan T, Zhang X, Li Y, Li R, Huang W, Xiao F, Zhang H Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Fig. S2A is meant to show OEF8A-HA interacting proteins found by MS/MS - but they only show "The top 20 significant enrichments of the gene ontology (GO) biological process terms.". Email sent to authors 27/5/20 requesting proteins identified - "high -confidence" ones! no reply expected....none received 8/6/20 10.1101/2020.05.24.111823 zhangh92@mail.sysu.edu.cn,zhangyw57@mail.sysu.edu.cn Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Jane Doe Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Fig. S2A is meant to show OEF8A-HA interacting proteins found by MS/MS - but they only show "The top 20 significant enrichments of the gene ontology (GO) biological process terms.". Email sent to authors 27/5/20 requesting proteins identified - "high -confidence" ones! no reply expected....none received 8/6/20 zhangh92@mail.sysu.edu.cn,zhangyw57@mail.sysu.edu.cn Accepted 2020-JUN-09 AT 07:51 BST AT 07:51 BST by KALPANAP 2020 imex curation ns8_sars2 ORF8 protein Non-structural protein 8 8 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI 912AD9E147A64907 hlaa_human HLA class I histocompatibility antigen, A alpha chain HLA-A HLAA Human leukocyte antigen A protein protein human Homo sapiens Human MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV DEDFCEC4450E0580 rep-hla_a-1 1 5 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level p.Pro208Ala variant variant certain certain sequence position certain certain certain sequence position certain P A p.Asp98His variant variant certain certain sequence position certain certain certain sequence position certain D H p.Ile121Arg variant variant certain certain sequence position certain certain certain sequence position certain I R p.Gly131Trp variant variant certain certain sequence position certain certain certain sequence position certain G W p.Ile166Thr variant variant certain certain sequence position certain certain certain sequence position certain I T p.Gly231Ser variant variant certain certain sequence position certain certain certain sequence position certain G S p.Glu277Gln variant variant certain certain sequence position certain certain certain sequence position certain E Q p.Leu300Pro variant variant certain certain sequence position certain certain certain sequence position certain L P p.Arg169His variant variant certain certain sequence position certain certain certain sequence position certain R H partial_ecd sufficient to bind sufficient binding region sufficient to bind range range range range p.Pro217_Ile218delinsAlaVal variant variant certain certain sequence position certain certain certain sequence position certain PI AV p.Gln86Glu variant variant certain certain sequence position certain certain certain sequence position certain Q E p.Asn90Lys variant variant certain certain sequence position certain certain certain sequence position certain N K p.Gln94His variant variant certain certain sequence position certain certain certain sequence position certain Q H p.Ile119Val variant variant certain certain sequence position certain certain certain sequence position certain I V p.Arg138His variant variant certain certain sequence position certain certain certain sequence position certain R H p.Asp140Tyr variant variant certain certain sequence position certain certain certain sequence position certain D Y p.Asn151Lys variant variant certain certain sequence position certain certain certain sequence position certain N K p.Glu176Val variant variant certain certain sequence position certain certain certain sequence position certain E V p.Asp185Glu variant variant certain certain sequence position certain certain certain sequence position certain D E 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2F Experiment was carried out in the presence of Bafilomycin A1 (Baf A1, an autophagy inhibitor). HLA-A201 sequence rep-hla_a-2 2 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed p.Pro208Ala variant variant certain certain sequence position certain certain certain sequence position certain P A p.Asp98His variant variant certain certain sequence position certain certain certain sequence position certain D H p.Ile121Arg variant variant certain certain sequence position certain certain certain sequence position certain I R p.Gly131Trp variant variant certain certain sequence position certain certain certain sequence position certain G W p.Ile166Thr variant variant certain certain sequence position certain certain certain sequence position certain I T p.Gly231Ser variant variant certain certain sequence position certain certain certain sequence position certain G S p.Glu277Gln variant variant certain certain sequence position certain certain certain sequence position certain E Q p.Leu300Pro variant variant certain certain sequence position certain certain certain sequence position certain L P p.Arg169His variant variant certain certain sequence position certain certain certain sequence position certain R H partial_ecd sufficient to bind sufficient binding region sufficient to bind range range range range p.Pro217_Ile218delinsAlaVal variant variant certain certain sequence position certain certain certain sequence position certain PI AV p.Gln86Glu variant variant certain certain sequence position certain certain certain sequence position certain Q E p.Asn90Lys variant variant certain certain sequence position certain certain certain sequence position certain N K p.Gln94His variant variant certain certain sequence position certain certain certain sequence position certain Q H p.Ile119Val variant variant certain certain sequence position certain certain certain sequence position certain I V p.Arg138His variant variant certain certain sequence position certain certain certain sequence position certain R H p.Asp140Tyr variant variant certain certain sequence position certain certain certain sequence position certain D Y p.Asn151Lys variant variant certain certain sequence position certain certain certain sequence position certain N K p.Glu176Val variant variant certain certain sequence position certain certain certain sequence position certain E V p.Asp185Glu variant variant certain certain sequence position certain certain certain sequence position certain D E region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2G Experiment was carried out in the presence of Bafilomycin A1 (Baf A1, an autophagy inhibitor). HLA-A201 sequence rep-hla_a-3 3 5 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level p.Pro208Ala variant variant certain certain sequence position certain certain certain sequence position certain P A p.Asp98His variant variant certain certain sequence position certain certain certain sequence position certain D H p.Ile121Arg variant variant certain certain sequence position certain certain certain sequence position certain I R p.Gly131Trp variant variant certain certain sequence position certain certain certain sequence position certain G W p.Ile166Thr variant variant certain certain sequence position certain certain certain sequence position certain I T p.Gly231Ser variant variant certain certain sequence position certain certain certain sequence position certain G S p.Glu277Gln variant variant certain certain sequence position certain certain certain sequence position certain E Q p.Leu300Pro variant variant certain certain sequence position certain certain certain sequence position certain L P p.Arg169His variant variant certain certain sequence position certain certain certain sequence position certain R H partial_ecd sufficient to bind sufficient binding region sufficient to bind range range range range p.Pro217_Ile218delinsAlaVal variant variant certain certain sequence position certain certain certain sequence position certain PI AV p.Gln86Glu variant variant certain certain sequence position certain certain certain sequence position certain Q E p.Asn90Lys variant variant certain certain sequence position certain certain certain sequence position certain N K p.Gln94His variant variant certain certain sequence position certain certain certain sequence position certain Q H p.Ile119Val variant variant certain certain sequence position certain certain certain sequence position certain I V p.Arg138His variant variant certain certain sequence position certain certain certain sequence position certain R H p.Asp140Tyr variant variant certain certain sequence position certain certain certain sequence position certain D Y p.Asn151Lys variant variant certain certain sequence position certain certain certain sequence position certain N K p.Glu176Val variant variant certain certain sequence position certain certain certain sequence position certain E V p.Asp185Glu variant variant certain certain sequence position certain certain certain sequence position certain D E 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 2E HLA-A201 sequence