MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria. Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 Narita M., Shimizu S., Ito T., Chittenden T., Lutz RJ., Matsuda H., Tsujimoto Y. Virus - Publications including interactions involving viral proteins no in vivo in vivo coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Narita M., Shimizu S., Ito T., Chittenden T., Lutz RJ., Matsuda H., Tsujimoto Y. Virus - Publications including interactions involving viral proteins no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria. Bax interacts with the permeability transition pore to induce permeability transition and cytochrome c release in isolated mitochondria. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 Narita M., Shimizu S., Ito T., Chittenden T., Lutz RJ., Matsuda H., Tsujimoto Y. Virus - Publications including interactions involving viral proteins no in vitro In vitro pull down pull down predetermined predetermined participant predetermined Narita M., Shimizu S., Ito T., Chittenden T., Lutz RJ., Matsuda H., Tsujimoto Y. Virus - Publications including interactions involving viral proteins no Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1998 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E vdac1_human Voltage-dependent anion-selective channel protein 1 VDAC1 VDAC Outer mitochondrial membrane protein porin 1 Plasmalemmal porin Porin 31HL Porin 31HM protein protein human Homo sapiens Human MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA DIP protein P21796 original sequence version: 103 DIP protein P21796 original sequence version: 123 DIP protein P21796 original sequence version: 125 89BA3378B04020D5 bax_mouse Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG D2E0B3566579FAFF vdac1-bak1 1 3 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint vdac1-bax 1 4 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed Stoichiometry: 1.0 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed Stoichiometry: 1.0 physical association physical association homomint mint vdac1-bak1-1 2 4 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 3 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint vdac1-bax-1 2 5 unspecified role unspecified role prey prey purified purified Stoichiometry: 1.0 4 unspecified role unspecified role bait bait purified purified Stoichiometry: 1.0 direct interaction direct interaction homomint mint