HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Involvement of endoplasmic reticulum chaperones in the folding of hepatitis C virus glycoproteins. Involvement of endoplasmic reticulum chaperones in the folding of hepatitis C virus glycoproteins. J. Virol. (0022-538X) 1998 imex curation Choukhi A., Ung S., Wychowski C., Dubuisson J. Virus - Publications including interactions involving viral proteins jdubuis@infobiogen.fr 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Choukhi A., Ung S., Wychowski C., Dubuisson J. Virus - Publications including interactions involving viral proteins jdubuis@infobiogen.fr Accepted 2014-APR-01 by ORCHARD J. Virol. (0022-538X) 1998 imex curation Involvement of endoplasmic reticulum chaperones in the folding of hepatitis C virus glycoproteins. Involvement of endoplasmic reticulum chaperones in the folding of hepatitis C virus glycoproteins. J. Virol. (0022-538X) 1998 imex curation Choukhi A., Ung S., Wychowski C., Dubuisson J. Virus - Publications including interactions involving viral proteins jdubuis@infobiogen.fr 14-Apr-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation mesau-bhk Mesocricetus auratus baby kidney cell line BHK bhk Golden (Syrian) Hamster baby kidney cell line BHK Established from the kidneys of five unsexed, one-day-old hamsters in 1961. anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Choukhi A., Ung S., Wychowski C., Dubuisson J. Virus - Publications including interactions involving viral proteins Calreticulin was also identified to interact with E1 and/or E2 jdubuis@infobiogen.fr Accepted 2014-APR-01 by ORCHARD J. Virol. (0022-538X) 1998 imex curation q920l9_mesau EMEP Canx CNX protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MEGKWLLCMLLVLGTAIVEAHDGHDDDMIDIEDDLDDVIEEVEDSKSKSDSSTPPSPKVTYKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKDTKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQFHDKTPYTKMFGPDKCGEXYKLHFIFRHKNPKTGVYEEKHAKRPDAHLKMYFTDRKTHLYTLVLNPDNSFEILVDQFIVNSGNLLNDMTPAVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYIPDPDADKPEDWDEDMDGEWEAPQIANPKCESAPGCGVRQRPEIDNPNYKGKWKPPMIDIPNYQGVWKPRKIPNPDFFEDDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSSAMQYKKTDAPQPDVKEEDGKEEEKNKGDEEEEGEEKLEEKQKSDAEDDGGTGSQDEEDRKPTAEEDEILNRSPRNRKPRRE 9D01E83DC2ECF036 bip_mesau Endoplasmic reticulum chaperone BiP HSPA5 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 Immunoglobulin heavy chain-binding protein GRP78 protein protein mesau Mesocricetus auratus (Golden hamster) Golden hamster MKFPMVAAALLLLCAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTSEKDEL DIP protein P07823 original sequence version: 67 25CF665F59113A49 p27958-pro_0000037570 Envelope glycoprotein E2 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) ETHVTGGNAGRTTAGLVGLLTPGAKQNIQLINTNGSWHINSTALNCNESLNTGWLAGLFYQHKFNSSGCPERLASCRRLTDFAQGWGPISYANGSGLDERPYCWHYPPRPCGIVPAKSVCGPVYCFTPSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPLGNWFGCTWMNSTGFTKVCGAPPCVIGGVGNNTLLCPTDCFRKYPEATYSRCGSGPRITPRCMVDYPYRLWHYPCTINYTIFKVRMYVGGVEHRLEAACNWTRGERCDLEDRDRSELSPLLLSTTQWQVLPCSFTTLPALSTGLIHLHQNIVDVQYLYGVGSSIASWAIKWEYVVLLFLLLADARVCSCLWMMLLISQAEA 384 746 9243E2103B6CCA2D tunicamycin tunicamycin Tunicamycin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) castanospermine castanospermine (1S,6S,7R,8R,8aR)-1,6,7,8-tetrahydroxyindolizidine (1S-(1alpha,6beta,7alpha,8beta,8alphabeta))-octahydro-1,6,7,8-indolizinetetrol 1,6,7,8-tetrahydroxyoctahydroindolizine Castanospermine CASTANOSPERMINE castinospermine (1S,6S,7R,8R,8aR)-octahydroindolizine-1,6,7,8-tetrol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) JDVVGAQPNNXQDW-TVNFTVLESA-N JDVVGAQPNNXQDW-TVNFTVLESA-N p27958-pro_0000037569 Envelope glycoprotein E1 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) YQVRNSSGLYHVTNDCPNSSVVYEAADAILHTPGCVPCVREGNASRCWVAVTPTVATRDGKLPTTQLRRHIDLLVGSATLCSALYVGDLCGSVFLVGQLFTFSPRHHWTTQDCNCSIYPGHITGHRMAWNMMMNWSPTAALVVAQLLRIPQAIMDMIAGAHWGVLAGIKYFSMVGNWAKVLVVLLLFAGVDA 192 383 62EDCA90D2CEBCE8 cnx-p27958_pro-1 2 7 inhibitor inhibitor unspecified role unspecified role 3 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1, 3, 4 and 6 Ttunicamycin and castanospermine (CST) inhibit e1-calnexin interaction. CST is an α-glucosidase inhibitor that prevents glucose trimming. As such, it inhibits glycoprotein binding to calnexin. e1-bip-2 2 4 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1, 3, 4 and 6 e2-bip-2 2 5 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1, 3, 4 and 6 e2-calnexin-1 2 3 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1, 3, 4 and 6 In fig. 6 data shows that tunicamycin inhibit e2-calnexin interaction e1-e2-calnexin-1 2 3 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4 e1-e2-bip-1 2 8 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 4 e2-bip-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 2 ATP inhibits E2-BIP interaction e1-bip-1 1 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. 2 ATP inhibits E1-BIP interaction e1-e2-12 2 8 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1 cnx-p27958_pro-2 2 6 inhibitor inhibitor unspecified role unspecified role 3 unspecified role unspecified role bait bait 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 1, 3, 4 and 6 Tunicamycin and castanospermine (CST) inhibit e1-calnexin interaction. Tunicamycin blocks core glycosylation of nascent glycoprotein precursors. Results suggest that in the absence of their N-linked oligosaccharides, HCV glycoproteins are unable to fold properly.