HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Accepted 2013-JUL-30 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Accepted 2013-JUL-30 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. Complex formation of NS5B with NS3 and NS4A proteins of hepatitis C virus. Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Ishido S., Fujita T., Hotta H. Virus - Publications including interactions involving viral proteins hotta@kobe-u.ac.jp Accepted 2013-JUL-30 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 1998 imex curation p27958-pro_0000037573 Serine protease/helicase NS3 protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQTYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPTGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAKGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADAGCSGGAYDIIICDECHSTDATSISGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTSGDVVVVSTDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELTPAETTVRLRAYMNTPGLPVCQDHLGFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMRKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEVVT 1027 1657 5601AD5882D04C8F p27958-pro_0000037574 Non-structural protein 4A protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) STWVLVGGVLAALAAYCLSTGCVVIVGRIVLSGKPAIIPDREVLYQEFDEMEEC 1658 1711 527EC748BC450589 p27958-pro_0000037577 RNA-directed RNA polymerase protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRKKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLAPPHSAKSKFGYGAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGLSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCRASRVLTTSCGNTLTRYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRAWSVRARLLARGGKAAICGKYLFNWAVRTKLKLTPITAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 2F89B19E29A81A02 ns3-ns5b-6 3 NS3 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS5B 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 1 ns3-ns5b-ns4a-2 3 NS3 4 unspecified role unspecified role neutral component neutral component NS4A 5 unspecified role unspecified role neutral component neutral component NS5B 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 4 p27958_pro-ns5b-1 1 NS3 4 unspecified role unspecified role bait bait NS4A 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 5 ns3-ns5b-7 1 NS3 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS5B 6 unspecified role unspecified role prey prey physical association physical association 2 ns3-ns5b-ns4a-1 1 NS3 4 unspecified role unspecified role prey prey NS5B 6 unspecified role unspecified role prey prey NS4A 5 unspecified role unspecified role bait bait association association 5 ns4a-ns5b-4 1 NS4A 5 unspecified role unspecified role bait bait NS5B 6 unspecified role unspecified role prey prey physical association physical association 6 ns4a-ns5b-1 1 NS4A 5 unspecified role unspecified role prey prey NS5B 6 unspecified role unspecified role bait bait physical association physical association 6 ns3-ns5b-2 2 NS3 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain NS5B 6 unspecified role unspecified role prey prey physical association physical association 3 ns3-ns5b-ns4a-3 1 NS3 4 unspecified role unspecified role prey prey NS5B 6 unspecified role unspecified role bait bait NS4A 5 unspecified role unspecified role prey prey association association 5