MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Transformation suppression by protein tyrosine phosphatase 1B requires a functional SH3 ligand. Transformation suppression by protein tyrosine phosphatase 1B requires a functional SH3 ligand. Mol. Cell. Biol. (0270-7306) 1998 Liu F., Sells MA., Chernoff J. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B rapid curation rat-3y1 Rat embryonic fibroblast 3Y1 cells 3y1 rat embyronic fibroblast line 3y1 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Liu F., Sells MA., Chernoff J. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B PTP1B Mol. Cell. Biol. (0270-7306) 1998 rapid curation Transformation suppression by protein tyrosine phosphatase 1B requires a functional SH3 ligand. Transformation suppression by protein tyrosine phosphatase 1B requires a functional SH3 ligand. Mol. Cell. Biol. (0270-7306) 1998 Liu F., Sells MA., Chernoff J. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B rapid curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Liu F., Sells MA., Chernoff J. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B PTP1B PTP1B Mol. Cell. Biol. (0270-7306) 1998 rapid curation Transformation suppression by protein tyrosine phosphatase 1B requires a functional SH3 ligand. Transformation suppression by protein tyrosine phosphatase 1B requires a functional SH3 ligand. Mol. Cell. Biol. (0270-7306) 1998 Liu F., Sells MA., Chernoff J. Virus - Publications including interactions involving viral proteins Phosphatases PTP1B rapid curation rat-3y1 Rat embryonic fibroblast 3Y1 cells 3y1 rat embyronic fibroblast line 3y1 phosphatase assay phosphatase assay predetermined predetermined participant predetermined Liu F., Sells MA., Chernoff J. Virus - Publications including interactions involving viral proteins Phosphatases Phosphatases PTP1B PTP1B PTP1B Mol. Cell. Biol. (0270-7306) 1998 rapid curation bcar1_human Breast cancer anti-estrogen resistance protein 1 CRK-associated substrate p130cas BCAR1 CAS CRKAS CASS1 Cas scaffolding protein family member 1 protein protein human Homo sapiens Human MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPSNHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA DIP protein P56945 original sequence version: 113 DIP protein P56945 original sequence version: 116 B81EC3430049E795 fak1_mouse Focal adhesion kinase 1 Ptk2 Fadk Fak Fak1 Kiaa4203 pp125FAK Protein-tyrosine kinase 2 Focal adhesion kinase-related nonkinase p125FAK protein protein mouse Mus musculus Mouse MAAAYLDPNLNHTPSSSTKTHLGTGMERSPGAMERVLKVFHYFESSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMQEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYLSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGIPAMAGSIYQGQASLLDQTELWNHRPQEMSMWQPSVEDSAALDLRGMGQVLPPHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSFQGPTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLSNLSSISSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPALPASTHREIEMAQKLLNSDLGELISKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH 4B7453C5D81F0F63 bcar1_mouse Breast cancer anti-estrogen resistance protein 1 Bcar1 Cas Crkas p130cas CRK-associated substrate protein protein mouse Mus musculus Mouse MTVPNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPVGPGPGPPATPPQPQPSLPQGVHAPVPPASQYSPMLPTAYQPQSDNVYLVPTPSKTQQGLYQAPGPNPQFQSPPAKQTSTFSKQTPHHSFPSPATDLYQVPPGPGSPAQDIYQVPPSAGIGHDIYQVPPSLDTRGWEGTKPPAKVVVPTRVGQGYVYEAAQTEQDEYDTPRHLLAPGPQDIYDVPPVRGLLPNQYGQEVYDTPPMAVKGPNGRDPLLDVYDVPPSVEKGLLSSSHHSVYDVPPSVSKDVPDGPLLREETYDVPPAFAKPKPFDPTRHPLILAAPPPDSPAAEDVYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGSVVDDGVYAVPPPAEREAPTDGKRLSASSTGSTRSSQSASSLEVVVPGREPLELEVAVESLARLQQGVSTTVAHLLDLVGSASGPGGWRGTSEPQEPPAQDLKAAVAAVHGAVHELLEFARGAVSNATHTSDRTLHAKLSRQLQKMEDVYQTLVVHGQVLDSGRGSPGFTPEDLDRLVACSRAVPEDAKQLASFLHGNASLLFRRTKAPGPGPEGSSSLHPNPTDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLERGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLVPGRTGGLGPSDRQLLLFYLEQCEANLTTLTDAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVDRVKELGHSTQQFRRVLGQLAAA 81E56BC7AD87B095 paxi_mouse Paxillin Pxn protein protein mouse Mus musculus Mouse MDDLDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTVLDPLDQWQPSGSRYAHQQPPSPLPVYSSSAKNSSASNTQDGVGSLCSRAGEEEHVYSFPNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHSPPGFPADEAESSPPLPGALSPLYGIPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQGEMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKMQGLEQRVDGERPWAAGWPPSSRQSSPEGQDEGGFMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFVKLFC B41A1892E6F60544 gagc_avisc P47(GAG-CRK) protein protein protein avisc Avian sarcoma virus (strain CT10) MEAVIKVISSACKTYCGKTSPSKKEIGAMLSLLQKEGLLMSPSDLYSPRSWDPITAALTQRAMELGKSGELKTWGLVLGALEAAREEQEQVTSEQAKFWLGLGGGRVSPPGPECIEKPATERRIDKGEEVGETTVQRDAKMAPEETATPKTVGTSCYYCGAAIGCNCATASAPPPPYVGSGLYPSLAGVGEQQGQGGDTPRGAEQPRAGRGAGHRGLRRPAGRGQRVRPAGGAALMAGQFDSEDRGSWYWGRLSRGDAVSLLQGQRHGTFLVRDSGSIPGDFVLSVSESSRVSHYIVNSLGPAGGRRAGGEGPGAPGLNPTRFLIGDQVFDSLPSLLEFYKIHYLDTTTLIEPVSRSRQNSGVILRQEEVEYVRALFDFKGNDDGDLPFKKGDILKIRDKPEEQWWNAEDMDGKRGMIPVPYVEKCRPSSASVSTLTGGR mint 0DB543862E8982AC ptn1_human Tyrosine-protein phosphatase non-receptor type 1 PTPN1 PTP1B Protein-tyrosine phosphatase 1B protein protein human Homo sapiens Human MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT DIP protein P18031 original sequence version: 141 DIP protein P18031 original sequence version: 191 802377DCD33F41FD ptpn1-bcar1-6 2 PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P18031:p.Pro310Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:51:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:42:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro310ala' Tue Jun 30 16:30:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro310Ala' range MINT-6787686: original sequence: 310-310 : EPPPEHIPPPPRPPKRILEP gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Pro309Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:10:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:32:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro309ala' Tue Jun 30 16:56:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro309Ala' range MINT-6762448: original sequence: 309-309 : LEPPPEHIPPPPRPPKRILE p130cas 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6762455: original sequence: 6-65 : VLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILV direct interaction direct interaction F1 The trapping mutant C\S PTP1B does not alter the binding to p130CAS homomint mint bcar1-ptpn1-3 3 p130cas 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Cys215Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Tue Jul 12 10:12:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:31:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 17:40:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' range MINT-6762467: original sequence: 215-215 : SPEHGPVVVHCSAGIGRSGT binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined dephosphorylation dephosphorylation reaction dephosphorylation F4 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. The phosphatase overexpression causes the dephosphorylation of predicted substrate in v-crk trasfected cells. homomint mint bcar1-ptpn1-3 3 PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Pro310Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:52:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:45:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro310ala' Tue Jun 30 19:06:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro310Ala' range MINT-6787640: original sequence: 310-310 : EPPPEHIPPPPRPPKRILEP P18031:p.Pro309Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:53:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:11:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro309ala' Tue Jun 30 20:16:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro309Ala' range MINT-6762505: original sequence: 309-309 : LEPPPEHIPPPPRPPKRILE p130cas 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dephosphorylation dephosphorylation reaction dephosphorylation F4 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. The phosphatase overexpression causes the dephosphorylation of predicted substrate in v-crk trasfected cells. homomint mint ptpn1-pxn-2 3 PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Cys215Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Tue Jul 12 10:53:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:30:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 17:21:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' range MINT-6762543: original sequence: 215-215 : SPEHGPVVVHCSAGIGRSGT binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dephosphorylation dephosphorylation reaction dephosphorylation F4 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. The phosphatase overexpression causes the dephosphorylation of predicted substrate in v-crk trasfected cells. homomint mint ptpn1-pxn-3 3 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell P18031:p.Pro310Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:15:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:08:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro310ala' Tue Jun 30 18:29:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro310Ala' range MINT-6787656: original sequence: 310-310 : EPPPEHIPPPPRPPKRILEP ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Pro309Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:15:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:21:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro309ala' Tue Jun 30 15:57:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro309Ala' range MINT-6762557: original sequence: 309-309 : LEPPPEHIPPPPRPPKRILE binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined dephosphorylation dephosphorylation reaction dephosphorylation F4 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. The phosphatase overexpression causes the dephosphorylation of predicted substrate in v-crk trasfected cells. homomint mint ptk2-ptpn1-1 3 PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P18031:p.Cys215Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Tue Jul 12 10:06:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:52:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys215ser' Tue Jun 30 19:45:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys215Ser' range MINT-6762569: original sequence: 215-215 : SPEHGPVVVHCSAGIGRSGT Fak 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dephosphorylation dephosphorylation reaction dephosphorylation F4 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. The phosphatase overexpression causes the dephosphorylation of predicted substrate in v-crk trasfected cells. homomint mint ptk2-ptpn1-1 3 Fak 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PTP-1B 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component over-expressed over expressed level over-expressed living cell living cell P18031:p.Pro310Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:06:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:21:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro310ala' Tue Jun 30 18:08:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro310Ala' range MINT-6787676: original sequence: 310-310 : EPPPEHIPPPPRPPKRILEP P18031:p.Pro309Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:49:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:35:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro309ala' Tue Jun 30 18:16:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro309Ala' range MINT-6762581: original sequence: 309-309 : LEPPPEHIPPPPRPPKRILE binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined dephosphorylation dephosphorylation reaction dephosphorylation F4 No evidence for a direct de-phosphorylation is reported in this experiments. Anyway the curator was self confident to indicate this interaction as an evidence of a direct phosphatase effect on the indicated protein. The phosphatase overexpression causes the dephosphorylation of predicted substrate in v-crk trasfected cells. homomint mint bcar1-gagc 1 v-CRK 8 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell p130cas 6 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5 The PTP1B overexpression decreases this interaction. homomint mint