MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. J. Virol. (0022-538X) 1997 rapid curation Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins suggested by tinti rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins suggested by tinti suggested by tinti J. Virol. (0022-538X) 1997 rapid curation rapid curation Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. J. Virol. (0022-538X) 1997 rapid curation Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins suggested by tinti rapid curation unknown Unknown fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins suggested by tinti suggested by tinti J. Virol. (0022-538X) 1997 rapid curation rapid curation Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3. J. Virol. (0022-538X) 1997 rapid curation Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins suggested by tinti rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Kawaguchi Y., Van Sant C., Roizman B. Virus - Publications including interactions involving viral proteins suggested by tinti suggested by tinti J. Virol. (0022-538X) 1997 rapid curation rapid curation ccnd3_human G1/S-specific cyclin-D3 CCND3 protein protein human Homo sapiens Human MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL DIP protein P30281 original sequence version: 150 DIP protein P30281 original sequence version: 111 16E7B1604FEB0029 icp0_hhv11 E3 ubiquitin-protein ligase ICP0 ICP0 Alpha-0 protein IE110 Immediate-early protein IE110 Trans-acting transcriptional protein ICP0 VMW110 RING-type E3 ubiquitin transferase ICP0 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MEPRPGASTRRPEGRPQREPAPDVWVFPCDRDLPDSSDSEAETEVGGRGDADHHDDDSASEADSTDTELFETGLLGPQGVDGGAVSGGSPPREEDPGSCGGAPPREDGGSDEGDVCAVCTDEIAPHLRCDTFPCMHRFCIPCMKTWMQLRNTCPLCNAKLVYLIVGVTPSGSFSTIPIVNDPQTRMEAEEAVRAGTAVDFIWTGNQRFAPRYLTLGGHTVRALSPTHPEPTTDEDDDDLDDADYVPPAPRRTPRAPPRRGAAAPPVTGGASHAAPQPAAARTAPPSAPIGPHGSSNTNTTTNSSGGGGSRQSRAAAPRGASGPSGGVGVGVGVVEAEAGRPRGRTGPLVNRPAPLANNRDPIVISDSPPASPHRPPAAPMPGSAPRPGPPASAAASGPARPRAAVAPCVRAPPPGPGPRAPAPGAEPAARPADARRVPQSHSSLAQAANQEQSLCRARATVARGSGGPGVEGGHGPSRGAAPSGAAPLPSAASVEQEAAVRPRKRRGSGQENPSPQSTRPPLAPAGAKRAATHPPSDSGPGGRGQGGPGTPLTSSAASASSSSASSSSAPTPAGAASSAAGAASSSASASSGGAVGALGGRQEETSLGPRAASGPRGPRKCARKTRHAETSGAVPAGGLTRYLPISGVSSVVALSPYVNKTITGDCLPILDMETGNIGAYVVLVDQTGNMATRLRAAVPGWSRRTLLPETAGNHVMPPEYPTAPASEWNSLWMTPVGNMLFDQGTLVGALDFRSLRSRHPWSGEQGASTRDEGKQ DIP protein P08393 original sequence version: 101 DIP protein P08393 original sequence version: 113 DF38A1C539DAB15C icp0-ccnd3 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association NFA homomint mint ccnd3-icp0 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F6 homomint mint ccnd3-icp0-1 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization F7 homomint mint