IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-CoV-2 Exacerbates COVID-19 Pathology Through Activation of the Complement and Kinin Systems. SARS-CoV-2 Exacerbates COVID-19 Pathology Through Activation of the Complement and Kinin Systems. Frontiers in immunology 2020 imex curation Savitt AG., Manimala S., White T., Fandaros M., Yin W., Duan H., Xu X., Geisbrecht BV., Rubenstein DA., Kaplan AP., Peerschke EI., Ghebrehiwet B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus HK and Factor XII; the species origin of these two proteins is not stated, however they have been assumed to be of Human origin based on previous work by the last author, Berhane Ghebrehiwet, see-PMID: 22282702. (they were obtained from Enzyme Research Lab.) Similarly, ghA (globular head of the A chain of C1q) has been assumed to be of Human origin - pmid:28018340. berhane.ghebrehiwet@ stonybrook.edu Only protein-protein interactions imex curation in vitro In vitro solid phase assay solid phase assay tag visualisation tag visualisation Savitt AG., Manimala S., White T., Fandaros M., Yin W., Duan H., Xu X., Geisbrecht BV., Rubenstein DA., Kaplan AP., Peerschke EI., Ghebrehiwet B. Virus - Publications including interactions involving viral proteins figure 5 uses no antibody so is not an ELISA. fig 4 is stated to have been done using the "same strategy", but DOES use an antibody for detection hence IS an elisa. HK and Factor XII; the species origin of these two proteins is not stated, however they have been assumed to be of Human origin based on previous work by the last author, Berhane Ghebrehiwet, see-PMID: 22282702. (they were obtained from Enzyme Research Lab.) Similarly, ghA (globular head of the A chain of C1q) has been assumed to be of Human origin - pmid:28018340. berhane.ghebrehiwet@ stonybrook.edu Accepted 2022-JAN-10 AT 07:19 GMT AT 07:19 GMT by ORCHARD Frontiers in immunology 2020 Only protein-protein interactions imex curation imex curation SARS-CoV-2 Exacerbates COVID-19 Pathology Through Activation of the Complement and Kinin Systems. SARS-CoV-2 Exacerbates COVID-19 Pathology Through Activation of the Complement and Kinin Systems. Frontiers in immunology 2020 imex curation Savitt AG., Manimala S., White T., Fandaros M., Yin W., Duan H., Xu X., Geisbrecht BV., Rubenstein DA., Kaplan AP., Peerschke EI., Ghebrehiwet B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus HK and Factor XII; the species origin of these two proteins is not stated, however they have been assumed to be of Human origin based on previous work by the last author, Berhane Ghebrehiwet, see-PMID: 22282702. (they were obtained from Enzyme Research Lab.) Similarly, ghA (globular head of the A chain of C1q) has been assumed to be of Human origin - pmid:28018340. berhane.ghebrehiwet@ stonybrook.edu Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Savitt AG., Manimala S., White T., Fandaros M., Yin W., Duan H., Xu X., Geisbrecht BV., Rubenstein DA., Kaplan AP., Peerschke EI., Ghebrehiwet B. Virus - Publications including interactions involving viral proteins figure 5 uses no antibody so is not an ELISA. fig 4 is stated to have been done using the "same strategy", but DOES use an antibody for detection hence IS an elisa. HK and Factor XII; the species origin of these two proteins is not stated, however they have been assumed to be of Human origin based on previous work by the last author, Berhane Ghebrehiwet, see-PMID: 22282702. (they were obtained from Enzyme Research Lab.) Similarly, ghA (globular head of the A chain of C1q) has been assumed to be of Human origin - pmid:28018340. berhane.ghebrehiwet@ stonybrook.edu Accepted 2022-JAN-10 AT 07:19 GMT AT 07:19 GMT by ORCHARD Frontiers in immunology 2020 Only protein-protein interactions imex curation imex curation SARS-CoV-2 Exacerbates COVID-19 Pathology Through Activation of the Complement and Kinin Systems. SARS-CoV-2 Exacerbates COVID-19 Pathology Through Activation of the Complement and Kinin Systems. Frontiers in immunology 2020 imex curation Savitt AG., Manimala S., White T., Fandaros M., Yin W., Duan H., Xu X., Geisbrecht BV., Rubenstein DA., Kaplan AP., Peerschke EI., Ghebrehiwet B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus HK and Factor XII; the species origin of these two proteins is not stated, however they have been assumed to be of Human origin based on previous work by the last author, Berhane Ghebrehiwet, see-PMID: 22282702. (they were obtained from Enzyme Research Lab.) Similarly, ghA (globular head of the A chain of C1q) has been assumed to be of Human origin - pmid:28018340. berhane.ghebrehiwet@ stonybrook.edu Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Savitt AG., Manimala S., White T., Fandaros M., Yin W., Duan H., Xu X., Geisbrecht BV., Rubenstein DA., Kaplan AP., Peerschke EI., Ghebrehiwet B. Virus - Publications including interactions involving viral proteins figure 5 uses no antibody so is not an ELISA. fig 4 is stated to have been done using the "same strategy", but DOES use an antibody for detection hence IS an elisa. The gC1qR deletion mutant with the removal of the flexible, negatively charged loops (i.e., gC1qR-ΔΔ) has been taken from PMID: 22282702. This construct is missing aas 144-148 and 191-196 from the full length protein. The sequence of HKH20 peptide (aas 497-516 from High molecular weight kininogen- full length protein and His479-His498 from the "mature protein"), was found from the literature from multiple sources e.g. pmid: 19604396, 26351912. HK and Factor XII; the species origin of these two proteins is not stated, however they have been assumed to be of Human origin based on previous work by the last author, Berhane Ghebrehiwet, see-PMID: 22282702. (they were obtained from Enzyme Research Lab.) Similarly, ghA (globular head of the A chain of C1q) has been assumed to be of Human origin - pmid:28018340. berhane.ghebrehiwet@ stonybrook.edu Accepted 2022-JAN-10 AT 07:19 GMT AT 07:19 GMT by ORCHARD Frontiers in immunology 2020 Only protein-protein interactions imex curation imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method ncap_sars2 Nucleoprotein N Nucleocapsid protein protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA vme1_sars2 Membrane protein E1 glycoprotein Matrix glycoprotein Membrane glycoprotein M protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ kng1_human Kininogen-1 KNG1 BDK KNG Alpha-2-thiol proteinase inhibitor Fitzgerald factor High molecular weight kininogen Williams-Fitzgerald-Flaujeac factor protein protein human Homo sapiens Human MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDLTDGLS 3132B4DF2954C24E spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT c1qb_human Complement C1q subcomponent subunit B C1QB protein protein human Homo sapiens Human MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA D80C753C0D430EDC q07021-pro_0000018590 Complement component 1 Q subcomponent-binding protein, mitochondrial C1QBP GC1QBP HABP1 SF2P32 ASF/SF2-associated protein p32 Glycoprotein gC1qBP Hyaluronan-binding protein 1 Mitochondrial matrix protein p32 gC1q-R protein p33 protein protein human Homo sapiens Human LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ 74 282 1C491151D53345A4 p0c0l5-pro_0000042704 C4d-B Basic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3 C4B CO4 CPAMD3 C4B_2 protein protein human Homo sapiens Human TLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR 957 1336 3D7AFA789446CD6C vemp_sars2 Envelope small membrane protein E 4 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV c1qc_human Complement C1q subcomponent subunit C C1QC C1QG protein protein human Homo sapiens Human MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD FA17117EB7ABFC12 c1qa_human Complement C1q subcomponent subunit A C1QA protein protein human Homo sapiens Human MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA DIP protein P02745 original sequence version: null 8FF6B6AE02D49C4C fa12_human Coagulation factor XII F12 Hageman factor protein protein human Homo sapiens Human MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRTNPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQPWASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQAAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS F5B861BF635EB480 p0c0l4-pro_0000042698 C4d-A Acidic complement C4 C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2 C4A CO4 CPAMD2 protein protein human Homo sapiens Human TLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHTTEERGLNVTLSSTGR 957 1336 8D2432CC50E4122B vme1_sars2-c1q_human-1 2 19 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 6 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2A vme1_sars2-c1q_human-2 2 19 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 5 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 2A c1qbp-c1q_human-1 2 19 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 10 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) physical association physical association 2A vme1_sars2-c1q_human-3 2 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 6 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2B e-c4a-1 2 11 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 16 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level human-serum Homo sapiens serum Serum 12 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 2B dear checker; all pooled sera will have a mixture of the proteins derived from the two alleles of C4. vme1_sars2-kng1-1 2 7 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A n-kng1-1 2 7 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A s-kng1-1 2 7 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 8 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 3A vme1_sars2-f12-1 2 15 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 6 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B n-f12-1 2 15 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 5 unspecified role unspecified role bait bait purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B s-kng1-2 2 15 unspecified role unspecified role prey prey purified purified human-plasma homo sapiens blood plasma plasma blood plasma 8 unspecified role unspecified role bait bait purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3B c1qbp-c1q_human-2 1 12 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 67 71 physical association physical association 5 An M/E fusion protein was stated to have been used, but no further info is given. for M/E fusion the supplier does not state if the intervening nucleotides were retained between M and E; the CDSs for both genes are adjoining. It is also possible some aas were omitted and the order could be other than E 5' to M. e-c1qbp-1 1 10 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 5 n-c1qbp-1 1 10 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction 5 c1qa-c1qbp-5 1 10 unspecified role unspecified role prey prey purified purified region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait purified purified head region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 5 Positive control c1qbp-e-2 3 12 unspecified role unspecified role prey prey purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait purified purified DD_loop mutant sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey purified purified whole molecule sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 87 92 physical association physical association 6 An M/E fusion protein was stated to have been used, but no further info is given. for M/E fusion the supplier does not state if the intervening nucleotides were retained between M and E; the CDSs for both genes are adjoining. It is also possible some aas were omitted and the order could be other than E 5' to M. c1qbp-e-1 3 12 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait purified purified DD_loop mutant sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 6 c1qbp-s-1 3 8 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait purified purified DD_loop mutant sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 6 c1qbp-kng1-1 3 7 unspecified role unspecified role prey prey purified purified HKH20 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 unspecified role unspecified role bait bait purified purified DD_loop mutant sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 6 positive control c1q_human Complement component C1q complex C1q Complement 1q C1QA-C1QB-C1QC complex 6xC1QA:6xC1QB:6xC1QC 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role cys-31 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 110 116 113 111 117 114 120 114 135 129 120 135 156 119 126 123 129 153 122 125 132 128 144 153 156 131 143 141 137 134 140 138 149 146 152 150 147 159 155 162 161 158 physical association physical association human Homo sapiens Human stable complex stable complex physical interaction evidence used in manual assertion physical interaction evidence used in manual assertion IPI inferred from physical interaction Complement component C1q deficiency (C1QD) [MONDO:0013343]: a disorder caused by impaired activation of the complement classical pathway. It generally leads to severe immune complex disease with features of systemic lupus erythematosus and glomerulonephritis. coronavirus The complex comprises of six heterotrimeric collagen-like triple helices, formed from triplets of the A, B, and C chains, that associate in their N-terminal half to form a stalk, then diverge to form individual stems, each terminating in a C-terminal globular domain. Each of the six heterotrimeric globular heads or domains is made up of the globular domains from one A, one B, and one C chain, each of which in turn has its own ligand specificity. The six collagen-like stalks appear to be fibril-like and exist in the central region. The collagen-like region and the globular heads can independently interact with a multiplicity of biological structures including pathogen-associated and cell associated molecules, also each of the individual globular head domains is capable of independently interacting with specific ligands. Chains A and B are disulfide-linked whilst the C chain forms a disulfide bond with the C chain of the next strand. Molecular weight 460 kDa. Recognition unit of the classical pathway of complement which associates with the Ca2+ - dependent C1r(2)-C1s(2) tetramer to form C1 (CPX-1920), the first component of the classical complement system. The complex's role in C1 is the recognition of immune complexes, or other molecules, which trigger the classical pathway of the complement system. Independent of complement activation C1q appears to have additional roles in homeostasis and cellular development, superoxide (O2-) production by neutrophils, blood coagulation and neurological synapse pruning. Heterooctadecamer created with intact-jami-dbscripts