IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Communications chemistry 2020 imex curation Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). Nucleotidyl-monophosphate transferase activity-NMPylation;protein guanylylation. EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Accepted 2021-SEP-17 AT 13:14 BST AT 13:14 BST by ORCHARD Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Communications chemistry 2020 imex curation Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Only protein-protein interactions imex curation in vitro In vitro enzymatic study enzymatic study sequence tag sequence tag identification sequence tag Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). Nucleotidyl-monophosphate transferase activity-NMPylation;protein guanylylation. The assays were carried out in the presence of nucleotides : GTP, or 15N-GTP, or 13C-GTP. EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Accepted 2021-SEP-17 AT 13:14 BST AT 13:14 BST by ORCHARD Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Communications chemistry 2020 imex curation Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Only protein-protein interactions imex curation in vitro In vitro uridylation assay uridylation assay sequence tag sequence tag identification sequence tag Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Accepted 2021-SEP-17 AT 13:14 BST AT 13:14 BST by ORCHARD Communications chemistry 2020 Only protein-protein interactions imex curation imex curation Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Mass spectrometric based detection of protein nucleotidylation in the RNA polymerase of SARS-CoV-2. Communications chemistry 2020 imex curation Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Only protein-protein interactions imex curation in vitro In vitro uridylation assay uridylation assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Conti BJ., Leicht AS., Kirchdoerfer RN., Sussman MR. Virus - Publications including interactions involving viral proteins they do not give an accession number for EAV Nsp7 and 9 - only Nsp3 and 8, for some reason. (found in supplement). EAV Nsp7 has been entered as aas 1453-1677 from Uniprot P19811 based on blasting peptide sequences from Table 1. Similarly for Nsp9. msussman@wisc.edu Accepted 2021-SEP-17 AT 13:14 BST AT 13:14 BST by ORCHARD Communications chemistry 2020 Only protein-protein interactions imex curation imex curation rpoa_eavbu Replicase polyprotein 1ab rep 1a-1b ORF1ab polyprotein protein protein EAV Equine arteritis virus (strain Bucyrus) MATFSATGFGGSFVRDWSLDLPDACEHGAGLCCEVDGSTLCAECFRGCEGMEQCPGLFMGLLKLASPVPVGHKFLIGWYRAAKVTGRYNFLELLQHPAFAQLRVVDARLAIEEASVFISTDHASAKRFPGARFALTPVYANAWVVSPAANSLIVTTDQEQDGFCWLKLLPPDRREAGLRLYYNHYREQRTGWLSKTGLRLWLGDLGLGINASSGGLKFHIMRGSPQRAWHITTRSCKLKSYYVCDISEADWSCLPAGNYGGYNPPGDGACGYRCLAFMNGATVVSAGCSSDLWCDDELAYRVFQLSPTFTVTIPGGRVCPNAKYAMICDKQHWRVKRAKGVGLCLDESCFRGICNCQRMSGPPPAPVSAAVLDHILEAATFGNVRVVTPEGQPRPVPAPRVRPSANSSGDVKDPAPVPPVPKPRTKLATPNPTQAPIPAPRTRLQGASTQEPLASAGVASDSAPKWRVAKTVYSSAERFRTELVQRARSVGDVLVQALPLKTPAVQRYTMTLKMMRSRFSWHCDVWYPLAVIACLLPIWPSLALLLSFAIGLIPSVGNNVVLTALLVSSANYVASMDHQCEGAACLALLEEEHYYRAVRWRPITGALSLVLNLLGQVGYVARSTFDAAYVPCTVFDLCSFAILYLCRNRCWRCFGRCVRVGPATHVLGSTGQRVSKLALIDLCDHFSKPTIDVVGMATGWSGCYTGTAAMERQCASTVDPHSFDQKKAGATVYLTPPVNSGSALQCLNVMWKRPIGSTVLGEQTGAVVTAVKSISFSPPCCVSTTLPTRPGVTVVDHALYNRLTASGVDPALLRVGQGDFLKLNPGFRLIGGWIYGICYFVLVVVSTFTCLPIKCGIGTRDPFCRRVFSVPVTKTQEHCHAGMCASAEGISLDSLGLTQLQSYWIAAVTSGLVILLVCHRLAISALDLLTLASPLVLLVFPWASVGLLLACSLAGAAVKIQLLATLFVNLFFPQATLVTMGYWACVAALAVYSLMGLRVKVNVPMCVTPAHFLLLARSAGQSREQMLRVSAAAPTNSLLGVARDCYVTGTTRLYIPKEGGMVFEGLFRSPKARGNVGFVAGSSYGTGSVWTRNNEVVVLTASHVVGRANMATLKIGDAMLTLTFKKNGDFAEAVTTQSELPGNWPQLHFAQPTTGPASWCTATGDEEGLLSGEVCLAWTTSGDSGSAVVQGDAVVGVHTGSNTSGVAYVTTPSGKLLGADTVTLSSLSKHFTGPLTSIPKDIPDNIIADVDAVPRSLAMLIDGLSNRESSLSGPQLLLIACFMWSYLNQPAYLPYVLGFFAANFFLPKSVGRPVVTGLLWLCCLFTPLSMRLCLFHLVCATVTGNVISLWFYITAAGTSYLSEMWFGGYPTMLFVPRFLVYQFPGWAIGTVLAVCSITMLAAALGHTLLLDVFSASGRFDRTFMMKYFLEGGVKESVTASVTRAYGKPITQESLTATLAALTDDDFQFLSDVLDCRAVRSAMNLRAALTSFQVAQYRNILNASLQVDRDAARSRRLMAKLADFAVEQEVTAGDRVVVIDGLDRMAHFKDDLVLVPLTTKVVGGSRCTICDVVKEEANDTPVKPMPSRRRRKGLPKGAQLEWDRHQEEKRNAGDDDFAVSNDYVKRVPKYWDPSDTRGTTVKIAGTTYQKVVDYSGNVHYVEHQEDLLDYVLGKGSYEGLDQDKVLDLTNMLKVDPTELSSKDKAKARQLAHLLLDLANPVEAVNQLNLRAPHIFPGDVGRRTFADSKDKGFVALHSRTMFLAARDFLFNIKFVCDEEFTKTPKDTLLGYVRACPGYWFIFRRTHRSLIDAYWDSMECVYALPTISDFDVSPGDVAVTGERWDFESPGGGRAKRLTADLVHAFQGFHGASYSYDDKVAAAVSGDPYRSDGVLYNTRWGNIPYSVPTNALEATACYRAGCEAVTDGTNVIATIGPFPEQQPIPDIPKSVLDNCADISCDAFIAPAAETALCGDLEKYNLSTQGFVLPSVFSMVRAYLKEEIGDAPPLYLPSTVPSKNSQAGINGAEFPTKSLQSYCLIDDMVSQSMKSNLQTATMATCKRQYCSKYKIRSILGTNNYIGLGLRACLSGVTAAFQKAGKDGSPIYLGKSKFDPIPAPDKYCLETDLESCDRSTPALVRWFATNLIFELAGQPELVHSYVLNCCHDLVVAGSVAFTKRGGLSSGDPITSISNTIYSLVLYTQHMLLCGLEGYFPEIAEKYLDGSLELRDMFKYVRVYIYSDDVVLTTPNQHYAASFDRWVPHLQALLGFKVDPKKTVNTSSPSFLGCRFKQVDGKCYLASLQDRVTRSLLYHIGAKNPSEYYEAAVSIFKDSIICCDEDWWTDLHRRISGAARTDGVEFPTIEMLTSFRTKQYESAVCTVCGAAPVAKSACGGWFCGNCVPYHAGHCHTTSLFANCGHDIMYRSTYCTMCEGSPKQMVPKVPHPILDHLLCHIDYGSKEELTLVVADGRTTSPPGRYKVGHKVVAVVADVGGNIVFGCGPGSHIAVPLQDTLKGVVVNKALKNAAASEYVEGPPGSGKTFHLVKDVLAVVGSATLVVPTHASMLDCINKLKQAGADPYFVVPKYTVLDFPRPGSGNITVRLPQVGTSEGETFVDEVAYFSPVDLARILTQGRVKGYGDLNQLGCVGPASVPRNLWLRHFVSLEPLRVCHRFGAAVCDLIKGIYPYYEPAPHTTKVVFVPNPDFEKGVVITAYHKDRGLGHRTIDSIQGCTFPVVTLRLPTPQSLTRPRAVVAVTRASQELYIYDPFDQLSGLLKFTKEAEAQDLIHGPPTACHLGQEIDLWSNEGLEYYKEVNLLYTHVPIKDGVIHSYPNCGPACGWEKQSNKISCLPRVAQNLGYHYSPDLPGFCPIPKELAEHWPVVSNDRYPNCLQITLQQVCELSKPCSAGYMVGQSVFVQTPGVTSYWLTEWVDGKARALPDSLFSSGRFETNSRAFLDEAEEKFAAAHPHACLGEINKSTVGGSHFIFSQYLPPLLPADAVALVGASLAGKAAKAACSVVDVYAPSFEPYLHPETLSRVYKIMIDFKPCRLMVWRNATFYVQEGVDAVTSALAAVSKLIKVPANEPVSFHVASGYRTNALVAPQAKISIGAYAAEWALSTEPPPAGYAIVRRYIVKRLLSSTEVFLCRRGVVSSTSVQTICALEGCKPLFNFLQIGSVIGPV CB536C1F5091045C p19811-pro_0000036626 RNA-directed RNA polymerase rep ORF1ab polyprotein 1a-1b protein protein EAV Equine arteritis virus (strain Bucyrus) GLDQDKVLDLTNMLKVDPTELSSKDKAKARQLAHLLLDLANPVEAVNQLNLRAPHIFPGDVGRRTFADSKDKGFVALHSRTMFLAARDFLFNIKFVCDEEFTKTPKDTLLGYVRACPGYWFIFRRTHRSLIDAYWDSMECVYALPTISDFDVSPGDVAVTGERWDFESPGGGRAKRLTADLVHAFQGFHGASYSYDDKVAAAVSGDPYRSDGVLYNTRWGNIPYSVPTNALEATACYRAGCEAVTDGTNVIATIGPFPEQQPIPDIPKSVLDNCADISCDAFIAPAAETALCGDLEKYNLSTQGFVLPSVFSMVRAYLKEEIGDAPPLYLPSTVPSKNSQAGINGAEFPTKSLQSYCLIDDMVSQSMKSNLQTATMATCKRQYCSKYKIRSILGTNNYIGLGLRACLSGVTAAFQKAGKDGSPIYLGKSKFDPIPAPDKYCLETDLESCDRSTPALVRWFATNLIFELAGQPELVHSYVLNCCHDLVVAGSVAFTKRGGLSSGDPITSISNTIYSLVLYTQHMLLCGLEGYFPEIAEKYLDGSLELRDMFKYVRVYIYSDDVVLTTPNQHYAASFDRWVPHLQALLGFKVDPKKTVNTSSPSFLGCRFKQVDGKCYLASLQDRVTRSLLYHIGAKNPSEYYEAAVSIFKDSIICCDEDWWTDLHRRISGAARTDGVEFPTIEMLTSFRTKQYE 1678 2370 5CACE9C3CD2B78EF p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 rep-270 1 6 putative self putative self putative self putative self purified purified P19811-PRO_0000036626:p.Lys380Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 18:48:37 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys380Ala' C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction true 1A, Supp. figure 12 A weak band only, is visible. Addition of nsp7 resulted in higher levels of radionucleotide incorporation into both Nsp7 and Nsp9. Nsp7 rep-271 1 5 enzyme target enzyme target substrate substrate neutral component neutral component nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 6 enzyme enzyme neutral component neutral component purified purified P19811-PRO_0000036626:p.Lys380Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 19:06:32 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys380Ala' C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1A, 5 B/C, Supp. figure 12 In competition experiments GTP outcompeted UTP, whereas adenosine triphosphate (ATP) and cytidine triphosphate (CTP) did not compete. rep-rep-270 1 8 predetermined predetermined participant predetermined weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1B rep-rep-271 1 9 predetermined predetermined participant predetermined weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1B rep-rep-272 1 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 9 predetermined predetermined participant predetermined weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTD1-PRO_0000449629:p.Arg116Lys mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain R K Tue Oct 05 18:58:04 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Lys' P0DTD1-PRO_0000449629:p.Arg116Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain R A Tue Oct 05 18:42:47 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg116Ala' spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 1 B/C, 5 B/C In competition experiments GTP outcompeted UTP, whereas adenosine triphosphate (ATP) and cytidine triphosphate (CTP) did not compete. rep-rep-273 2 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified lys2 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P0DTD1-PRO_0000449625:p.Ser1Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Oct 05 19:22:55 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1Ala' P0DTD1-PRO_0000449625:p.Ser1_Lys2delinsAlaAla mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain SK AA Tue Oct 05 18:59:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1_Lys2delinsAlaAla' ser1 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P0DTD1-PRO_0000449625:p.Lys2Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 19:30:57 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys2Ala' ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Table 1, Figure 4C, Supp. figure 6/7/8 The data indicates that lysine-2 is the preferred acceptor site for GMP. The modification site (Ser1) was not confirmed by Alanine mutation. rep-rep-274 2 5 enzyme target enzyme target substrate substrate neutral component neutral component P19811:p.Thr1455Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Tue Oct 05 18:30:59 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1455Ala' lys1595 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain K A resulting-ptm resulting-ptm resulting ptm resulting-ptm P19811:p.Lys1595Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 19:23:40 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1595Ala' P19811:p.Lys1608Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 19:38:09 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1608Ala' lys1608 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm lys1624 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P19811:p.Lys1624Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 18:33:02 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1624Ala' nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range thr 1455 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 6 enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Table 1, Supp. figure 11 rep-275 2 6 putative self putative self putative self putative self purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lys380 guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm P19811-PRO_0000036626:p.Lys380Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction true Table 1, Supp. figure 11 rep-rep-275 1 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified P0DTD1-PRO_0000449625:p.Ser1_Lys2delinsAlaAla mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain SK AA Tue Oct 05 18:53:25 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1_Lys2delinsAlaAla' P0DTD1-PRO_0000449625:p.Lys2Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 18:39:24 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys2Ala' region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm P0DTD1-PRO_0000449625:p.Ser1Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain S A Tue Oct 05 19:07:58 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1Ala' ecoli Escherichia coli (strain K12) 9 predetermined predetermined participant predetermined weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction 4 A/B rep-276 4 6 putative self putative self putative self putative self purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation true 5A not sure if this interaction should be here? rep-rep-276 4 5 enzyme target enzyme target substrate substrate neutral component neutral component nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 6 enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation 5A rep-rep-277 4 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 9 predetermined predetermined participant predetermined weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme target enzyme target substrate substrate neutral component neutral component purified purified region uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation 5A rep-rep-281 3 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified ser1 uridylated residue uridylated residue 5'phos Uridinyl PhosphoUridine uridine phosphodiester certain certain sequence position certain certain certain sequence position certain resulting-ptm resulting-ptm resulting ptm resulting-ptm ecoli Escherichia coli (strain K12) 7 sequence tag sequence tag identification sequence tag sequence tag sequence tag identification sequence tag enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. uridylation uridylation reaction uridylation 5 D/E, Supp. Table 6 rep-rep-280 1 5 enzyme target enzyme target substrate substrate neutral component neutral component P19811:p.Lys1595Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 18:39:34 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1595Ala' nsp7_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range region guanylated residue guanylated residue 5'phos Guanosyl Phosphoguanosine phospho-guanosine undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined resulting-ptm resulting-ptm resulting ptm resulting-ptm P19811:p.Thr1455Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain T A Tue Oct 05 19:18:53 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1455Ala' P19811:p.Lys1608Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 18:48:55 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1608Ala' P19811:p.Lys1624Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Oct 05 19:32:58 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'P19811:p.Lys1608Ala' ecoli Escherichia coli (strain K12) 6 enzyme enzyme neutral component neutral component purified purified C-terminus strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_21 Spodoptera frugiperda insect cells sf_21 Insect cells derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae. full name: IPLB-SF-21-AE cells are susceptible to Baculovirus infection. enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Supp. figure 12