IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Comparing the binding properties of peptides mimicking the Envelope protein of SARS-CoV and SARS-CoV-2 to the PDZ domain of the tight junction-associated PALS1 protein. Comparing the binding properties of peptides mimicking the Envelope protein of SARS-CoV and SARS-CoV-2 to the PDZ domain of the tight junction-associated PALS1 protein. Protein science : a publication of the Protein Society 2020 imex curation Toto A., Ma S., Malagrinò F., Visconti L., Pagano L., Stromgaard K., Gianni S. Chromatin - Epigenetic interactions resulting in chromatin modulation Virus - Publications including interactions involving viral proteins stefano.gianni@uniroma1.it 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Toto A., Ma S., Malagrinò F., Visconti L., Pagano L., Stromgaard K., Gianni S. Chromatin - Epigenetic interactions resulting in chromatin modulation I think all of figure 2 results are variations on FRET. (I do not see any results other than text, for the competition binding - so not entered.) PALS1 is of Human species origin based on figure 1A (PDB: 4UU5). However no sequence or expression system is stated. stefano.gianni@uniroma1.it Accepted 2021-MAY-05 AT 13:01 BST AT 13:01 BST by ORCHARD Protein science : a publication of the Protein Society 2020 imex curation imex curation Comparing the binding properties of peptides mimicking the Envelope protein of SARS-CoV and SARS-CoV-2 to the PDZ domain of the tight junction-associated PALS1 protein. Comparing the binding properties of peptides mimicking the Envelope protein of SARS-CoV and SARS-CoV-2 to the PDZ domain of the tight junction-associated PALS1 protein. Protein science : a publication of the Protein Society 2020 imex curation Toto A., Ma S., Malagrinò F., Visconti L., Pagano L., Stromgaard K., Gianni S. Chromatin - Epigenetic interactions resulting in chromatin modulation Virus - Publications including interactions involving viral proteins stefano.gianni@uniroma1.it 24-May-2021: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro 2d-ir 2d-infrared spectrometry 2d-ir tag fluorescence tag visualisation by fluorescence tag fluorescence Toto A., Ma S., Malagrinò F., Visconti L., Pagano L., Stromgaard K., Gianni S. Chromatin - Epigenetic interactions resulting in chromatin modulation I think all of figure 2 results are variations on FRET. (I do not see any results other than text, for the competition binding - so not entered.) T‐jump kinetic binding experiment;for the measurement of very rapid reaction rates. Rapid change in temperature was driven by capacitive electrical discharge and detection was by fluorescence. PALS1 is of Human species origin based on figure 1A (PDB: 4UU5). However no sequence or expression system is stated. stefano.gianni@uniroma1.it Accepted 2021-MAY-05 AT 13:01 BST AT 13:01 BST by ORCHARD Protein science : a publication of the Protein Society 2020 imex curation imex curation vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV A6D9A31652DDA194 vemp_sars2 Envelope small membrane protein E 4 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV pals1_human Protein PALS1 PALS1 MAGUK p55 subfamily member 5 MPP5 Membrane protein, palmitoylated 5 Protein associated with Lin-7 1 protein protein human Homo sapiens Human MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR A3B2CB594E0908CA e-mpp5-7 1 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain F W Mon Jun 28 17:19:13 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe318Trp' PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range direct interaction direct interaction 2 A mpp5-e-6 1 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain F W Mon Jun 28 17:45:46 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe318Trp' PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range direct interaction direct interaction 2 A mpp5-e-7 2 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain F W Mon Jun 28 17:14:32 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe318Trp' PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range direct interaction direct interaction 2 B/C mpp5-e-5 2 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain F W Mon Jun 28 17:08:20 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe318Trp' PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range direct interaction direct interaction 2 B mpp5-e-8 1 4 competitor competitor competitor unspecified role unspecified role PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role fluorescence donor fluorescence donor PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain F W Mon Jun 28 17:40:59 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe318Trp' physical association physical association 2 D mpp5-e-9 1 3 competitor competitor competitor unspecified role unspecified role PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept PBM sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus dansyl label dansyl label 5-dimethylaminonaphthalene-1-sulfonyl tag dansyl tag 5-dimethylaminonaphthalene-1-sulfonyl tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role fluorescence donor fluorescence donor Q8N3R9:p.Phe318Trp mutation mutation certain certain sequence position certain certain certain sequence position certain F W Mon Jun 28 17:00:49 BST 2021 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe318Trp' PDZ domain sufficient to bind sufficient binding region sufficient to bind range range range range direct interaction direct interaction 2 D