IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-CoV-2 Spike Protein Interacts with Multiple Innate Immune Receptors. SARS-CoV-2 Spike Protein Interacts with Multiple Innate Immune Receptors. bioRxiv : the preprint server for biology 2020 imex curation Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD., Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Supplementary figure 1 interactions with plant lectins are not included as no origins/sources are given for any of these lectins:Concanavalin A. could be from several organisms; VVA is probably "Lectin from Vicia villosa (hairy vetch)" and is likely to be a mixture of lectins; GNA -Galanthus nivalis lectin, is also probably a mixture of proteins. Spike proteins from Acrobiosystems- some of these catalogue numbers cannot be found, so I have taken nearest appropriate one. rcummin1@bidmc.harvard.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD., Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD. Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Supplementary figure 1 interactions with plant lectins are not included as no origins/sources are given for any of these lectins:Concanavalin A. could be from several organisms; VVA is probably "Lectin from Vicia villosa (hairy vetch)" and is likely to be a mixture of lectins; GNA -Galanthus nivalis lectin, is also probably a mixture of proteins. Spike proteins from Acrobiosystems- some of these catalogue numbers cannot be found, so I have taken nearest appropriate one. Assays were carried out in the presence of Ca2+. rcummin1@bidmc.harvard.edu Accepted 2020-SEP-07 AT 17:26 BST AT 17:26 BST by LUANA bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation SARS-CoV-2 Spike Protein Interacts with Multiple Innate Immune Receptors. SARS-CoV-2 Spike Protein Interacts with Multiple Innate Immune Receptors. bioRxiv : the preprint server for biology 2020 imex curation Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD., Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Supplementary figure 1 interactions with plant lectins are not included as no origins/sources are given for any of these lectins:Concanavalin A. could be from several organisms; VVA is probably "Lectin from Vicia villosa (hairy vetch)" and is likely to be a mixture of lectins; GNA -Galanthus nivalis lectin, is also probably a mixture of proteins. Spike proteins from Acrobiosystems- some of these catalogue numbers cannot be found, so I have taken nearest appropriate one. rcummin1@bidmc.harvard.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD., Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD. Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Supplementary figure 1 interactions with plant lectins are not included as no origins/sources are given for any of these lectins:Concanavalin A. could be from several organisms; VVA is probably "Lectin from Vicia villosa (hairy vetch)" and is likely to be a mixture of lectins; GNA -Galanthus nivalis lectin, is also probably a mixture of proteins. Spike proteins from Acrobiosystems- some of these catalogue numbers cannot be found, so I have taken nearest appropriate one. rcummin1@bidmc.harvard.edu Accepted 2020-SEP-07 AT 17:26 BST AT 17:26 BST by LUANA bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation SARS-CoV-2 Spike Protein Interacts with Multiple Innate Immune Receptors. SARS-CoV-2 Spike Protein Interacts with Multiple Innate Immune Receptors. bioRxiv : the preprint server for biology 2020 imex curation Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD., Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Supplementary figure 1 interactions with plant lectins are not included as no origins/sources are given for any of these lectins:Concanavalin A. could be from several organisms; VVA is probably "Lectin from Vicia villosa (hairy vetch)" and is likely to be a mixture of lectins; GNA -Galanthus nivalis lectin, is also probably a mixture of proteins. Spike proteins from Acrobiosystems- some of these catalogue numbers cannot be found, so I have taken nearest appropriate one. rcummin1@bidmc.harvard.edu 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro array technology array technology predetermined predetermined participant predetermined Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD., Gao C., Zeng J., Jia N., Stavenhagen K., Matsumoto Y., Zhang H., Li J., Hume AJ., Mühlberger E., van Die I., Kwan J., Tantisira K., Emili A., Cummings RD. Virus - Publications including interactions involving viral proteins This entry has been curated from a pre-print and has not been peer-reviewed. If needed, the data in this entry will be amended once the manuscript has gone through peer-review. Supplementary figure 1 interactions with plant lectins are not included as no origins/sources are given for any of these lectins:Concanavalin A. could be from several organisms; VVA is probably "Lectin from Vicia villosa (hairy vetch)" and is likely to be a mixture of lectins; GNA -Galanthus nivalis lectin, is also probably a mixture of proteins. Spike proteins from Acrobiosystems- some of these catalogue numbers cannot be found, so I have taken nearest appropriate one. rcummin1@bidmc.harvard.edu Accepted 2020-SEP-07 AT 17:26 BST AT 17:26 BST by LUANA bioRxiv : the preprint server for biology 2020 Only protein-protein interactions imex curation imex curation compound 34 compound 34 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) compound 3 compound 3 small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) n(4)-{beta-d-glcnac-(1->2)-alpha-d-man-(1->3)-[beta-d-glcnac-(1->2)-alpha-d-man-(1->6)]-beta-d-man-(1->4)-beta-d-glcnacl-(1->4)-beta-d-glcnac}-asn residue N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAcl-(1->4)-beta-D-GlcNAc}-Asn residue (GlcNAc)4 (Man)3 (Asn)1 N(4)-{beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->3)-[beta-D-GlcNAc-(1->2)-alpha-D-Man-(1->6)]-beta-D-Man-(1->4)-beta-D-GlcNAcl-(1->4)-beta-D-GlcNAc}-L-Asn residue N(4)-{2-acetamido-2-deoxy-beta-D-glucopyranosyl-(1->2)-alpha-D-mannopyranosyl-(1->3)-[2-acetamido-2-deoxy-beta-D-glucopyranosyl-(1->2)-alpha-D-mannopyranosyl-(1->6)]-beta-D-mannopyranosyl-(1->4)-2-acetamido-2-deoxy-beta-D-glucopyranosyl-(1->4)-2-acetamido-2-deoxy-beta-D-glucopyranosyl}-L-asparagine residue small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) clc4m_human C-type lectin domain family 4 member M CD209 antigen-like protein 1 Dendritic cell-specific ICAM-3-grabbing non-integrin 2 DC-SIGN-related protein Liver/lymph node-specific ICAM-3-grabbing non-integrin CLEC4M CD209L CD209L1 CD299 protein protein human Homo sapiens Human MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGALVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE 0FADC99F72AEA593 spike_sars2 Spike glycoprotein S E2 Peplomer protein 2 protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT q8iun9-2 C-type lectin domain family 10 member A CLEC10A CLECSF13 CLECSF14 HML C-type lectin superfamily member 14 Macrophage lectin 2 protein protein human Homo sapiens Human MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEEASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEAGLGQTSQESH 5472EFF9EBC7AC19 ace2_human Angiotensin-converting enzyme 2 ACE2 UNQ868/PRO1885 Angiotensin-converting enzyme homolog Metalloprotease MPROT15 Angiotensin-converting enzyme-related carboxypeptidase protein protein human Homo sapiens Human MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYASIDISKGENNPGFQNTDDVQTSF mint Carboxypeptidase which converts angiotensin I to angiotensin 1-9, a peptide of unknown function, and angiotensin II to angiotensin 1-7, a vasodilator. Also able to hydrolyze apelin-13 and dynorphin-13 with high efficiency. May be an important regulator of heart function. In case of human coronaviruses SARS and HCoV-NL63 infections, serve as functional receptor for the spike glycoprotein of both coronaviruses 8EE6EB0A931550E8 cd209_human CD209 antigen CD209 CLEC4L C-type lectin domain family 4 member L Dendritic cell-specific ICAM-3-grabbing non-integrin 1 protein protein human Homo sapiens Human MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA DIP protein Q9NNX6 original sequence version: 125 DIP protein Q9NNX6 original sequence version: 127 A23FA246014533C0 mrc1_mouse Macrophage mannose receptor 1 Mrc1 protein protein mouse Mus musculus Mouse MRLLLLLAFISVIPVSVQLLDARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYEAMYSLLGNANGAVCAFPFKFENKWYADCTSAGRSDGWLWCGTTTDYDKDKLFGFCPLHFEGSERLWNKDPLTGILYQINSKSALTWHQARASCKQQNADLLSVTEIHEQMYLTGLTSSLSSGLWIGLNSLSVRSGWQWAGGSPFRYLNWLPGSPSSEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNNTLNPFIIPSASDVPTGCPNQWWPYAGHCYRIHREEKKIQKYALQACRKEGGDLASIHSIEEFDFIFSQLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLPGEPSHENNRQEDCVVMKGKDGYWADRACEQPLGYICKMVSQSHAVVPEGADKGCRKGWKRHGFYCYLIGSTLSTFTDANHTCTNEKAYLTTVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFRWTVDEQVQFTHWNADMPGRKAGCVAMKTGVAGGLWDVLSCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPENWGTTSKTSMCFKLYAKGKHEKKTWFESRDFCKAIGGELASIKSKDEQQVIWRLITSSGSYHELFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPGMSWNDINCEHLNNWICQIQKGKTLLPEPTPAPQDNPPVTADGWVIYKDYQYYFSKEKETMDNARAFCKKNFGDLATIKSESEKKFLWKYINKNGGQSPYFIGMLISMDKKFIWMDGSKVDFVAWATGEPNFANDDENCVTMYTNSGFWNDINCGYPNNFICQRHNSSINATAMPTTPTTPGGCKEGWHLYKNKCFKIFGFANEEKKSWQDARQACKGLKGNLVSIENAQEQAFVTYHMRDSTFNAWTGLNDINAEHMFLWTAGQGVHYTNWGKGYPGGRRSSLSYEDADCVVVIGGNSREAGTWMDDTCDSKQGYICQTQTDPSLPVSPTTTPKDGFVTYGKSSYSLMKLKLPWHEAETYCKDHTSLLASILDPYSNAFAWMKMHPFNVPIWIALNSNLTNNEYTWTDRWRVRYTNWGADEPKLKSACVYMDVDGYWRTSYCNESFYFLCKKSDEIPATEPPQLPGKCPESEQTAWIPFYGHCYYFESSFTRSWGQASLECLRMGASLVSIETAAESSFLSYRVEPLKSKTNFWIGMFRNVEGKWLWLNDNPVSFVNWKTGDPSGERNDCVVLASSSGLWNNIHCSSYKGFICKMPKIIDPVTTHSSITTKADQRKMDPQPKGSSKAAGVVTVVLLIVIGAGVAAYFFYKKRHALHIPQEATFENTLYFNSNLSPGTSDTKDLMGNIEQNEHAII FD568C1B812214D2 cd209-s-3 1 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 10:11:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1B, number 1 Pre-treatment of Spike with Endoglycosidase H = Uniprot P04067- cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding of DC-SIGN and L-SIGN was attenuated by Endoglycosidase H and eliminated by PNGase F. cd209-s-4 1 11 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1A, number 2 Pre-treatment of Spike with Endoglycosidase H = Uniprot P04067- cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding of DC-SIGN and L-SIGN was attenuated by Endoglycosidase H and eliminated by PNGase F. clec4m-s-1 1 11 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Fri Sep 18 23:56:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1A, number 1 Pre-treatment of Spike with Endoglycosidase H = Uniprot P04067- cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding of DC-SIGN and L-SIGN was attenuated by Endoglycosidase H and eliminated by PNGase F. cd209-s-5 1 7 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1B, number 2 Pre-treatment of Spike with Endoglycosidase H = Uniprot P04067- cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding of DC-SIGN and L-SIGN was attenuated by Endoglycosidase H and mostly eliminated by PNGase F. cd209-s-6 1 9 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Mon Sep 21 12:39:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1E, number 1 Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding of MGL was eliminated by PNGase F and Neuraminidase pre-treatment slightly increased binding. Pre-treatment of Spike with Neuraminidase from paenarthrobacter ureafaciens; a mixture of isozymes. Terminal sialic-acid residues are cleaved. clec10a-s-1 1 9 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey purified purified S1 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1E, number 2 Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding of MGL was almost eliminated by PNGase F and Neuraminidase pre-treatment slightly increased binding. Pre-treatment of Spike with Neuraminidase from paenarthrobacter ureafaciens; a mixture of isozymes. Terminal sialic-acid residues are cleaved. cd209-s-7 1 12 unspecified role unspecified role bait bait purified purified c_type_lectin domains sufficient to bind sufficient binding region sufficient to bind range range range range region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 10:59:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1C Pre-treatment of Spike with Endoglycosidase H = Uniprot P04067- cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins. Pre-treatment of Spike with PNGase F - Uniprot P21163- removes almost all N-linked oligosaccharides from glycoproteins. Binding was eliminated by Spike pre-treatment with both Endoglycosidase H and PNGase F. cd209-s-8 2 11 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 11:06:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1G clec4m-s-2 2 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Fri Sep 18 22:46:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1H mrc1-s-1 2 12 unspecified role unspecified role prey prey purified purified c_type_lectin domains sufficient to bind sufficient binding region sufficient to bind range range range range region fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 8 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 11:19:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1I clec10a-s-2 2 9 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Wed Sep 16 10:56:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1J s-clec4m-2 2 10 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role bait bait purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0DTC2:p.[Arg683Ala;Arg685Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Fri Sep 18 22:02:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg683Ala;Arg685Ala' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1K n(4)_{beta_d_glcnac_(1_>2)_alpha_d_man_(1_>3)_[beta_d_glcnac_(1_>2)_alpha_d_man_(1_>6)]_beta_d_man_(1_>4)_beta_d_glcnacl_(1_>4)_beta_d_glcnac}_asn residue-cd209-2 3 11 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5A, number 1 Binding was greatly attenuated by the presence of core Fucose. aeab-cd209-1 3 11 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5A, number 2 Binding was greatly attenuated by the presence of core Fucose. aeab-cd209-2 3 11 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5A, number 3 Positive control n(4)_{beta_d_glcnac_(1_>2)_alpha_d_man_(1_>3)_[beta_d_glcnac_(1_>2)_alpha_d_man_(1_>6)]_beta_d_man_(1_>4)_beta_d_glcnacl_(1_>4)_beta_d_glcnac}_asn residue-cd209-1 3 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5B, number 1 Binding was greatly attenuated by the presence of core Fucose. n(4)_{beta_d_glcnac_(1_>2)_[beta_d_glcnac_(1_>4)]_alpha_d_man_(1_>3)_[beta_d_glcnac_(1_>2)_alpha_d_man_(1_>6)]_beta_d_man_(1_>4)_beta_d_glcnac_(1_>4)_beta_d_glcnac}_l_asn residue-cd209-1 3 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5B, number 2 Binding was greatly attenuated by the presence of core Fucose. aeab-cd209-3 3 7 unspecified role unspecified role prey prey purified purified ecd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus fc-igg tag fc-igg tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. figure 5B, number 3 Positive control