IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis of RNA cap modification by SARS-CoV-2. Structural basis of RNA cap modification by SARS-CoV-2. Nature communications 2020 imex curation Viswanathan T., Arya S., Chan SH., Qi S., Dai N., Hromas RA., Park JG., Oladunni F., Martinez-Sobrido L., Gupta YK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This was originally found at:- https://doi.org/10.1101/2020.04.26.061705 The original PubMed ID was:32511383 guptay@uthscsa.edu Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Viswanathan T Virus - Publications including interactions involving viral proteins guptay@uthscsa.edu Accepted 2020-JUN-15 AT 10:15 BST AT 10:15 BST by LIVIAP 2020 Only protein-protein interactions imex curation imex curation Structural basis of RNA cap modification by SARS-CoV-2. Structural basis of RNA cap modification by SARS-CoV-2. Nature communications 2020 imex curation Viswanathan T., Arya S., Chan SH., Qi S., Dai N., Hromas RA., Park JG., Oladunni F., Martinez-Sobrido L., Gupta YK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This was originally found at:- https://doi.org/10.1101/2020.04.26.061705 The original PubMed ID was:32511383 guptay@uthscsa.edu Only protein-protein interactions imex curation in vitro In vitro mst microscale thermophoresis mst predetermined predetermined participant predetermined Viswanathan T Virus - Publications including interactions involving viral proteins guptay@uthscsa.edu Accepted 2020-JUN-15 AT 10:15 BST AT 10:15 BST by LIVIAP 2020 Only protein-protein interactions imex curation imex curation Structural basis of RNA cap modification by SARS-CoV-2. Structural basis of RNA cap modification by SARS-CoV-2. Nature communications 2020 imex curation Viswanathan T., Arya S., Chan SH., Qi S., Dai N., Hromas RA., Park JG., Oladunni F., Martinez-Sobrido L., Gupta YK. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus This was originally found at:- https://doi.org/10.1101/2020.04.26.061705 The original PubMed ID was:32511383 guptay@uthscsa.edu Only protein-protein interactions imex curation in vitro In vitro methyltransferase as methyltransferase assay methyltransferase as fingerprinting peptide massfingerprinting fingerprinting Viswanathan T Virus - Publications including interactions involving viral proteins guptay@uthscsa.edu Accepted 2020-JUN-15 AT 10:15 BST AT 10:15 BST by LIVIAP 2020 Only protein-protein interactions imex curation imex curation (n(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine(2-) (N(7)-methyl 5'-triphospho-guanosine)-adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) s-adenosyl-l-methionine S adenosyl Methionine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449633 2'-O-methyltransferase nsp16 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLIIRENNRVVISSDVLVNN 6799 7096 p0dtd1-pro_0000449628 Non-structural protein 10 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AGNATEVPANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQ 4254 4392 me7gpppauagaacuucgucgaguacgcucaa me7GpppAUAGAACUUCGUCGAGUACGCUCAA rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) GAUAGAACUUCGUCGAGUACGCUCAA adenosine adenosine (2R,3R,4S,5R)-2-(6-aminopurin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol 6-Amino-9-beta-D-ribofuranosyl-9H-purine 9-beta-D-Ribofuranosidoadenine 9-beta-D-ribofuranosyl-9H-purin-6-amine 9-beta-D-Ribofuranosyl-9H-purin-6-amine Ade-Rib Adenine Deoxyribonucleoside Adenocard Adenocor Adenoscan Adenosin ADENOSINE Adenosine adenosine Adenyldeoxyriboside Ado beta-D-Adenosine Deoxyadenosine Desoxyadenosine adenosine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rep-rep-84 1 9 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1 original Chebi ID was:- CHEBI:42924 (not yet approved by Chebi and may be a duplicate) (n(7)_methyl 5'_triphospho_guanosine)_adenosine(2_)-rep-1 2 5 unspecified role unspecified role neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified red_dye tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified red_dye tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2F me7gpppauagaacuucgucgaguacgcucaa-rep-1 3 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 3'FAM fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain 7me_Guanosine Triphosphate rna chemical modification RNA chemical modification RNA chemical modification post-transcriptional modification rna chemical modification certain certain sequence position certain certain certain sequence position certain r.2a>g mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain A G chemical synthesis Chemical synthesis (Chemical synthesis) 7 ancillary ancillary neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Figure 2G (n(7)_methyl 5'_triphospho_guanosine)_adenosine(2_)-rep-2 2 6 unspecified role unspecified role neutral component neutral component purified purified region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component adenosine_2′-O-ribose methylated residue carbohydrate chemical modification decreasing strength carbohydrate chemical modification decreasing interaction strength carbohydrate chemical modification decreasing strength undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component purified purified region fluorescent dye fluorescent dye label fluorescent dye undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 2F