IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Science (New York, N.Y.) 2020 imex curation Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Only protein-protein interactions imex curation in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins A fluorescent dye that binds to nucleic acids was used for gel staining. eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Accepted 2020-JUN-02 AT 17:18 BST AT 17:18 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Science (New York, N.Y.) 2020 imex curation Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Only protein-protein interactions imex curation in vitro In vitro 3d-em-single electron microscopy 3D single particle reconstruction 3D-EM-single structure determination identification by structure determination identification by structure determination structure determination Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins The co-expressed RdRp complex was incubated with additional E.coli expressed nsp7 and nsp8 before the final purification step, to improve the yield of heterotrimeric complex. eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Accepted 2020-JUN-02 AT 17:18 BST AT 17:18 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Science (New York, N.Y.) 2020 imex curation Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Only protein-protein interactions imex curation in vitro In vitro rna rna pol assay rna directed rna polymerase assay rna rna pol assay tag fluorescence tag visualisation by fluorescence tag fluorescence Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Accepted 2020-JUN-02 AT 17:18 BST AT 17:18 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Science (New York, N.Y.) 2020 imex curation Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Accepted 2020-JUN-02 AT 17:18 BST AT 17:18 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Structural basis for inhibition of the RNA-dependent RNA polymerase from SARS-CoV-2 by remdesivir. Science (New York, N.Y.) 2020 imex curation Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Only protein-protein interactions imex curation spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection electrophoresis electrophoretic mobility-based method electrophoresis predetermined predetermined participant predetermined Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE., Yin W., Mao C., Luan X., Shen DD., Shen Q., Su H., Wang X., Zhou F., Zhao W., Gao M., Chang S., Xie YC., Tian G., Jiang HW., Tao SC., Shen J., Jiang Y., Jiang H., Xu Y., Zhang S., Zhang Y., Xu HE. Virus - Publications including interactions involving viral proteins eric.xu@simm.ac.cn, zhang_yan@zju.edu.cn, shuyangzhang103@nrdrs.org, ycxu@simm.ac.cn Accepted 2020-JUN-02 AT 17:18 BST AT 17:18 BST by KALPANAP Science (New York, N.Y.) 2020 Only protein-protein interactions imex curation imex curation p0dtd1-pro_0000449625 Non-structural protein 7 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQ 3860 3942 p0dtd1-pro_0000449629 RNA-directed RNA polymerase nsp12 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV SADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQ 4393 5324 rna duplex template strand rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) UUUUUUUUUUAAUUCUUAAUCUCACAUAGC rmp RMP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rtp RTP small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) p0dtd1-pro_0000449626 Non-structural protein 8 rep ORF1ab polyprotein 1a-1b protein protein SARS-CoV-2 SARS-CoV-2 SARS-CoV-2 Severe acute respiratory syndrome coronavirus 2 2019-nCoV AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ 3943 4140 rna duplex primer strand rna ribonucleic acid RNA rna chemical synthesis Chemical synthesis (Chemical synthesis) GCUAUGUGAGAUUAAGUUAU rep-rep-77 2 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supplemental Table S1 rep-rep-78 2 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Supplemental Table S1 The sequence of the primer strand has been taken from Figure 1B and PDBe; this sequence differs from that given in the Methods section. rep-rep-79 3 11 ancillary ancillary neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 ancillary ancillary neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 enzyme enzyme neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 enzyme target enzyme target substrate substrate neutral component neutral component 3'cytosine binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 enzyme target enzyme target substrate substrate neutral component neutral component 5'guanosine binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5' FAM fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 42 44 rna elongation rna strand elongation rna elongation Figure 1C The sequence of the primer strand has been taken from Figure 1B and PDBe; this sequence differs from that given in the Methods section. The purified nsp12 alone showed little activity in binding to a 50-base partial double-stranded template-primer RNA (Fig. 1B and fig. S1E). rep-rep-81 3 10 inhibitor inhibitor neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 11 ancillary ancillary neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 ancillary ancillary neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 enzyme enzyme neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 enzyme target enzyme target substrate substrate neutral component neutral component 3'cytosine binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 enzyme target enzyme target substrate substrate neutral component neutral component 5'guanosine binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5' FAM fluorescein fluorescein label fluorescein certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 57 55 rna elongation rna strand elongation rna elongation Figure 1D The sequence of the primer strand has been taken from Figure 1B and PDBe; this sequence differs from that given in the Methods section. RTP ; the "NTP" from figure 1 Ref. 18 (PMID: 26934220) is -I think- the RMP molecule plus 2 phosphate groups rep-rep-80 4 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 11 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supplemental Figure 1A/B rep-rep-82 5 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supplemental Figure 1C rep-rep-83 1 11 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 6 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 8 unspecified role unspecified role neutral component neutral component 3'cytosine binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 12 unspecified role unspecified role neutral component neutral component 5'guanosine binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 83 85 physical association physical association Supp. Figure 1E The sequence of the primer strand has been taken from Figure 1B and PDBe; this sequence differs from that given in the Methods section.