IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Journal of virology 2017 imex curation Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay western blot western blot Immuno blot Immuno blot Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu Accepted 2020-APR-23 AT 09:38 BST AT 09:38 BST by PPORRAS Journal of virology 2017 Only protein-protein interactions imex curation imex curation Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Journal of virology 2017 imex curation Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins C-terminal range of ISG15 has been captured from 5tl6 crystal deposited in pdbe (28438633) spegan@uga.edu Accepted 2020-APR-23 AT 09:38 BST AT 09:38 BST by PPORRAS Journal of virology 2017 Only protein-protein interactions imex curation imex curation Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Journal of virology 2017 imex curation Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins The substrate is labelled with 7-Amino-4-methylcoumarin (AMC), a fluorescent probe for peptide labeling commonly used in the study of proteases. Conjugation of AMC via its amino group to a peptide substrate results in quenching of the fluorescent signal. Upon enzymatic cleavage of the peptide by proteases, AMC is released and its fluorescence can be used to quantify enzyme activity. spegan@uga.edu Accepted 2020-APR-23 AT 09:38 BST AT 09:38 BST by PPORRAS Journal of virology 2017 Only protein-protein interactions imex curation imex curation Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Structurally Guided Removal of DeISGylase Biochemical Activity from Papain-Like Protease Originating from Middle East Respiratory Syndrome Coronavirus. Journal of virology 2017 imex curation Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu 04-05-20: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD., Daczkowski CM., Goodwin OY., Dzimianski JV., Farhat JJ., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu Accepted 2020-APR-23 AT 09:38 BST AT 09:38 BST by PPORRAS Journal of virology 2017 Only protein-protein interactions imex curation imex curation r9qb93_tupbe protein protein Common tree shrew Tupaia belangeri Tupaia glis belangeri MGRDLKVKMLGGQEFMVPISDSMLAMELKQKITKKIGVPAFQQRLAIHPSGTVLQDRVPLGHQGLDSDSIVLLVVQSCDSPLNILVRNNKGRSSSYEVRLTQTVAHLKQLVSQQEGVQADLFWLSYEGRDMEDQKPLGEYGLMSQSTVYMHLRLRGG 0B726FC5E061ED29 k0bwd0_mers 2'-O-methyltransferase orf1ab 3C-like proteinase Growth factor-like peptide Guanine-N7 methyltransferase Helicase Host translation inhibitor nsp1 Leader protein NendoU Non-structural protein 10 Non-structural protein 2 Non-structural protein 3 Non-structural protein 4 Non-structural protein 6 Non-structural protein 7 Non-structural protein 8 Non-structural protein 9 ORF1ab polyprotein Papain-like proteinase RNA-directed RNA polymerase Replicase polyprotein 1ab Uridylate-specific endoribonuclease nsp5 p65 homolog nsp12 nsp14 nsp15 nsp13 nsp16 protein protein cv2ce Human betacoronavirus 2c EMC/2012 MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEKLSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFMVNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHYERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMAKDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQKDGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSAFIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGDSCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSVVSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVDKIRQLLKGVTLDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLGESFKKVATIPYKVCNSVKDTLAYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVASTYFLVRILQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRNAYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSKIIAVIYSGRESLIFPSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVGQLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPVKKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEVEASDLEEGESECISETSTEQVDVSHETSDDEWAAAVDEAFPLDEAEDVTESVQEEAQPVEVPVEDIAQVVIADTLQETPVVPDTVEVPPQVVKLPSAPQTIQPEVKEVAPVYEADTEQTQNVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAANTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDYTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLMQAGSVVRRVNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRLNKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHGWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQLVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVLLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKFTPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSKEDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYFKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFAKMLFMLPLAYFSDSKLGTTEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSVYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFCANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNWLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRKFYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVDCDTAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPFYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLCKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRGDNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKPDSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNLAFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLMYLCLPTFSMAPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGVYDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEIPYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNMFIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVYCGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQCAVIAVVAAVLNSLCICFVTSIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGPIVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTYAALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLYQPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAYTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINFCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCAWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQGKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQATKFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEPTTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALALCSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLTLVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNLTAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSRAWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQATLSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLSVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDSNENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQGRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNNLHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCVKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIPAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQAALPQSKDSNFLNRVRGSIVNARIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVKRHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYALRHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTVKFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMTDCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRCVLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRHRLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDFVVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYFEIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPTMTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYGGWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYRLANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANGNKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDYAAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYFLPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQYIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQTSLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSYFCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTEPLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYHITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQERYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTARVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTINALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLEPENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILYKGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVSRSMLGLTTQTVDSSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSFTNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYSRVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLGFSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQMLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYACWTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHSCFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVDDPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTRVHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIEDIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNLWSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLPTNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDIDVNSALNICFDIRDNCSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDVVKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGLENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNTAAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYPRLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNTCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGDCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKITEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIFWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTLSVSTDVLVNTYRKLR 3258BB881E7605D4 isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS DIP protein P05161 original sequence version: 130 DIP protein P05161 original sequence version: 142 DIP protein P05161 original sequence version: 155 DIP protein P05161 original sequence version: 96 DIP protein P05161 original sequence version: 141 DIP protein P05161 original sequence version: 168 DIP protein P05161 original sequence version: 150 B6858A15AB0FFFDE isg15-orf1ab-1 2 6 unspecified role unspecified role neutral component neutral component purified purified K0BWD0:p.Lys1657Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 17:24:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1657Glu' K0BWD0:p.Val1691Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V D Tue Jun 30 15:53:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1691Asp' protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1, Fig. 2a Papain-like protease domain range was inferred from the sequence provided in Fig. 1 isg15-orf1ab-2 4 7 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 2 2.41Å Rwork: 0.212 Rfree: 0.237 isg15-orf1ab-3 3 6 enzyme enzyme neutral component neutral component purified purified K0BWD0:p.Lys1547Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:27:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1547Ala' K0BWD0:p.Glu1551Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain E A Tue Jun 30 17:39:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu1551Ala' K0BWD0:p.Lys1608Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:20:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1608Ala' K0BWD0:p.Glu1659Arg mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E R Tue Jun 30 17:49:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu1659Arg' K0BWD0:p.Glu1659Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain E V Tue Jun 30 18:15:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu1659Val' K0BWD0:p.Gln1683Ala mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain Q A Tue Jun 30 16:18:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln1683Ala' K0BWD0:p.Lys1657Leu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain K L Tue Jun 30 17:38:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1657Leu' K0BWD0:p.Lys1657Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:49:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1657Ala' K0BWD0:p.Val1706Pro mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain V P Tue Jun 30 18:26:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1706Pro' K0BWD0:p.Val1706Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V D Tue Jun 30 18:02:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1706Asp' K0BWD0:p.Val1706Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain V A Tue Jun 30 16:03:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1706Ala' K0BWD0:p.Gln1708Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Q A Tue Jun 30 16:16:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln1708Ala' K0BWD0:p.Arg1713Val mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain R V Tue Jun 30 20:16:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1713Val' K0BWD0:p.Arg1713Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 18:34:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1713Ala' K0BWD0:p.Lys1657Glu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 16:13:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1657Glu' K0BWD0:p.Val1691Asp mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V D Tue Jun 30 20:14:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1691Asp' protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain K0BWD0:p.Arg1715Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R A Tue Jun 30 19:08:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1715Ala' 7 predetermined predetermined participant predetermined tag fluorescence tag visualisation by fluorescence tag fluorescence enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range protein cleavage protein cleavage Figs. 6b, 7b, Table 3 Papain-like protease domain range was inferred from the sequence provided in Fig. 1 isg15-orf1ab-4 1 6 enzyme enzyme neutral component neutral component purified purified K0BWD0:p.Lys1657Glu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain K E Tue Jun 30 19:21:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1657Glu' K0BWD0:p.Val1691Asp mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain V D Tue Jun 30 17:18:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val1691Asp' protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 8A Papain-like protease domain range was inferred from the sequence provided in Fig. 1 isg15-orf1ab-6 1 5 enzyme target enzyme target substrate substrate neutral component neutral component purified purified R9QB93:p.Ser144Pro mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain S P Tue Jun 30 18:59:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser144Pro' R9QB93:p.Gln145Leu mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain Q L Tue Jun 30 19:21:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln145Leu' pro-ISG15 sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 enzyme enzyme neutral component neutral component purified purified protease domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 5c