IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Journal of molecular biology 2017 imex curation Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu,scott.d.pegan@gmail.com 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu,scott.d.pegan@gmail.com Accepted 2020-SEP-16 AT 15:41 BST AT 15:41 BST by ORCHARD Journal of molecular biology 2017 Only protein-protein interactions imex curation imex curation Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Journal of molecular biology 2017 imex curation Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu,scott.d.pegan@gmail.com 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins Conjugation of the fluorescent probe, 7-Amino-4-methylcoumarin (AMC) via its amino group to a peptide substrate results in quenching of the fluorescent signal.Upon enzymatic cleavage of the peptide by proteases, AMC is released and its fluorescence can be used to quantify enzyme activity. spegan@uga.edu,scott.d.pegan@gmail.com Accepted 2020-SEP-16 AT 15:41 BST AT 15:41 BST by ORCHARD Journal of molecular biology 2017 Only protein-protein interactions imex curation imex curation Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Journal of molecular biology 2017 imex curation Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu,scott.d.pegan@gmail.com 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu,scott.d.pegan@gmail.com Accepted 2020-SEP-16 AT 15:41 BST AT 15:41 BST by ORCHARD Journal of molecular biology 2017 Only protein-protein interactions imex curation imex curation Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Structural Insights into the Interaction of Coronavirus Papain-Like Proteases and Interferon-Stimulated Gene Product 15 from Different Species. Journal of molecular biology 2017 imex curation Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus spegan@uga.edu,scott.d.pegan@gmail.com 28-Sep-2020: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Daczkowski CM., Dzimianski JV., Clasman JR., Goodwin O., Mesecar AD., Pegan SD. Virus - Publications including interactions involving viral proteins spegan@uga.edu,scott.d.pegan@gmail.com Accepted 2020-SEP-16 AT 15:41 BST AT 15:41 BST by ORCHARD Journal of molecular biology 2017 Only protein-protein interactions imex curation imex curation k9n638-pro_0000422456 Papain-like proteinase ORF1a polyprotein 1a protein protein cvemc Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) (Betacoronavirus England 1) Betacoronavirus England 1 Human coronavirus EMC APVKKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEVEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQPVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEADTEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAANTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGPDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVVNSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDYTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRRVNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRLNKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVNFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELYGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVIPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWREWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLLSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWKCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVLLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKFTPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSKEDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYFKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGTTEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSVYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFCANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNWLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRKFYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVDCDTAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPFYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLCKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRGDNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKPDSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNLAFRLTTSKLRANDNILSVRFTANKIVGG 854 2740 532E0D4BDE146A6E isg15_human Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS DIP protein P05161 original sequence version: 130 DIP protein P05161 original sequence version: 142 DIP protein P05161 original sequence version: 155 DIP protein P05161 original sequence version: 96 DIP protein P05161 original sequence version: 141 DIP protein P05161 original sequence version: 168 DIP protein P05161 original sequence version: 150 B6858A15AB0FFFDE p05161-pro_0000035986 Ubiquitin-like protein ISG15 ISG15 G1P2 UCRP Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein human Homo sapiens Human GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG 2 157 E9C9A44A35A60CB2 q9gkp4_sheep ISG17 protein protein sheep Ovis aries (Sheep) Sheep MGGDLKVKMLGGEEILVPLRDSMMVSELKQFIAQKINVPAFQQRLAHLDSREVLQEGVPLVHQGLKAGSTILLMVQNCSATLNILVRNDKGRSSSYEVQLTQTVAVLKQQVCQRERVQADQFWLSFEGKPMDDEHPLGEYGLTTGCTVFMNLRLRGG B2774014826BF5FA e0d5d4_oplfa ISG15 protein protein Barred knifejaw Oplegnathus fasciatus Scaradon fasciatus MEITVKMLEGTSCTLRVNPQDTVGSLKIRIQEKLGVPPQRQKLVFVNGQTTDLSDDSKPVSYYGLQSGSIVSLLVTQPPATFQVFLRNEKGQVSTYDVKPNESVSSFKTKVQCREGVPVSQQRLIYQGRDMTDGYKLSDYNVEALSTIELVLRLRGG 41005F31404CA3FA p0c6u8-pro_0000338257 Papain-like protease nsp3 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGG 819 2740 BBB1A6190358ADDE r9qb93_tupbe protein protein Common tree shrew Tupaia belangeri Tupaia glis belangeri MGRDLKVKMLGGQEFMVPISDSMLAMELKQKITKKIGVPAFQQRLAIHPSGTVLQDRVPLGHQGLDSDSIVLLVVQSCDSPLNILVRNNKGRSSSYEVRLTQTVAHLKQLVSQQEGVQADLFWLSYEGRDMEDQKPLGEYGLMSQSTVYMHLRLRGG 0B726FC5E061ED29 l5lc70_myods MDA_GLEAN10007532 protein protein David's myotis Myotis davidii MLSNEFQVPMRDSMLLSELKQLITQKIQVPAFRQRLLVQGSNEVLQDGVPLAHQGLRSGSEVVLVVQSCDRPLSILVRNDRGNNRAYEVQLTQKVARLKEQVAERESTNVDQFWLSFQGQPLDDEKQLGEYDLTPHCTVQMNLRLRGGEEGLGGQR 31A10DDD609CA3F5 isg15_mouse Ubiquitin-like protein ISG15 Isg15 G1p2 Ucrp Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Ubiquitin cross-reactive protein protein protein mouse Mus musculus Mouse MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSSTVMLVVQNCSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQFWLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGGGGDQCA In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy mint Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections 9C70D9A507979171 p0c6v0-pro_0000338281 Non-structural protein 3 ORF1a polyprotein 1a protein protein cvma5 Murine coronavirus (strain A59) MHV-A59 Murine hepatitis virus GKKVEFNDKPKVRKIPSTRKIKITFALDATFDSVLSKACSEFEVDKDVTLDELLDVVLDAVESTLSPCKEHDVIGTKVCALLDRLAGDYVYLFDEGGDEVIAPRMYCSFSAPDDEDCVAADVVDADENQDDDAEDSAVLVADTQEEDGVAKGQVEADSEICVAHTGSQEELAEPDAVGSQTPIASAEETEVGEASDREGIAEAKATVCADAVDACPDQVEAFEIEKVEDSILDELQTELNAPADKTYEDVLAFDAVCSEALSAFYAVPSDETHFKVCGFYSPAIERTNCWLRSTLIVMQSLPLEFKDLEMQKLWLSYKAGYDQCFVDKLVKSVPKSIILPQGGYVADFAYFFLSQCSFKAYANWRCLECDMELKLQGLDAMFFYGDVVSHMCKCGNSMTLLSADIPYTLHFGVRDDKFCAFYTPRKVFRAACAVDVNDCHSMAVVEGKQIDGKVVTKFIGDKFDFMVGYGMTFSMSPFELAQLYGSCITPNVCFVKGDVIKVVRLVNAEVIVNPANGRMAHGAGVAGAIAEKAGSAFIKETSDMVKAQGVCQVGECYESAGGKLCKKVLNIVGPDARGHGKQCYSLLERAYQHINKCDNVVTTLISAGIFSVPTDVSLTYLLGVVTKNVILVSNNQDDFDVIEKCQVTSVAGTKALSLQLAKNLCRDVKFVTNACSSLFSESCFVSSYDVLQEVEALRHDIQLDDDARVFVQANMDCLPTDWRLVNKFDSVDGVRTIKYFECPGGIFVSSQGKKFGYVQNGSFKEASVSQIRALLANKVDVLCTVDGVNFRSCCVAEGEVFGKTLGSVFCDGINVTKVRCSAIYKGKVFFQYSDLSEADLVAVKDAFGFDEPQLLKYYTMLGMCKWPVVVCGNYFAFKQSNNNCYINVACLMLQHLSLKFPKWQWQEAWNEFRSGKPLRFVSLVLAKGSFKFNEPSDSIDFMRVVLREADLSGATCNLEFVCKCGVKQEQRKGVDAVMHFGTLDKGDLVRGYNIACTCGSKLVHCTQFNVPFLICSNTPEGRKLPDDVVAANIFTGGSVGHYTHVKCKPKYQLYDACNVNKVSEAKGNFTDCLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQYYCESGKYYTKPIIKAQFRTFEKVDGVYTNFKLVGHSIAEKLNAKLGFDCNSPFVEYKITEWPTATGDVVLASDDLYVSRYSSGCITFGKPVVWLGHEEASLKSLTYFNRPSVVCENKFNVLPVDVSEPTDKGPVPAAVLVTGVPGADASAGAGIAKEQKACASASVEDQVVTEVRQEPSVSAADVKEVKLNGVKKPVKVEGSVVVNDPTSETKVVKSLSIVDVYDMFLTGCKYVVWTANELSRLVNSPTVREYVKWGMGKIVTPAKLLLLRDEKQEFVAPKVVKAKAIACYCAVKWFLLYCFSWIKFNTDNKVIYTTEVASKLTFKLCCLAFKNALQTFNWSVVSRGFFLVATVFLLWFNFLYANVILSDFYLPNIGPLPTFVGQIVAWFKTTFGVSTICDFYQVTDLGYRSSFCNGSMVCELCFSGFDMLDNYDAINVVQHVVDRRLSFDYISLFKLVVELVIGYSLYTVCFYPLFVLIGMQLLTTWLPEFFMLETMHWSARLFVFVANMLPAFTLLRFYIVVTAMYKVYCLCRHVMYGCSKPGCLFCYKRNRSVRVKCSTVVGGSLRYYDVMANGGTGFCTKHQWNCLNCNSWKPGNTFITHEAAADLSKELKRPVNPTDSAYYSVTEVKQVGCSMRLFYERDGQRVYDDVNASLFVDMNGLLHSKVKGVPETHVVVVENEADKAGFLGAAVFYAQSLYRPMLMVEKKLITTANTGLSVSRTMFDLYVDSLLNVLDVDRKSLTSFVNAAHNSLKEGVQLEQVMDTFIGCARRKCAIDSDVETKSITKSVMSAVNAGVDFTDESCNNLVPTYVKSDTIVAADLGVLIQNNAKHVQANVAKAANVACIWSVDAFNQLSADLQHRLRKACSKTGLKIKLTYNKQEANVPILTTPFSLKGG 833 2837 51398C8D075B43E9 a0a5n4dax7_camdr Cadr_000013024 protein protein camdr Camelus dromedarius Arabian camel MGGILKVKMLEGREIQVTLRDSMLLSELKQQIAQKIHVPTFQQRLAHPESQQVLKDGEPLVRQGLKPGDTVLLMVQNCEDPLSILVRNDKGRSSAYEVWLTQTVAELKRQVCQKEHAQADQFWLTFEGKPMEDQHQLGEYGLTARCTVYMNLRLRGGGAGPGGR 626354ABDB861688 isg15-p0c6u8_pro_0000338257-2 3 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-I isg15-k9n638_pro_0000422456-1 3 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-I The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain k9n638_pro_0000422456-r9qb93_tupbe-1 3 11 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-III The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain MERS PLpro exhibited weak enzymatic activity p0c6u8_pro_0000338257-r9qb93_tupbe-1 3 11 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-III pro_0000338281-r9qb93_tupbe-1 3 14 enzyme enzyme neutral component neutral component purified purified 11 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-III MHV PLpro demonstrated moderate enzyme activity for the northern tree shrew ISG15 protein isg15-k9n638_pro_0000422456-2 3 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-IV The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain isg15-pro_0000338281-1 3 14 enzyme enzyme neutral component neutral component purified purified 9 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-IV isg15-k9n638_pro_0000422456-3 3 13 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q64339:p.Cys76Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-V The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain isg15-p0c6u8_pro_0000338257-4 3 13 enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q64339:p.Cys76Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-V isg15-pro_0000338281-2 3 13 enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q64339:p.Cys76Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 14 enzyme enzyme neutral component neutral component purified purified protein cleavage protein cleavage Fig. 2-V a0a5n4dax7_camdr-k9n638_pro_0000422456-1 3 15 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-VI The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain isg15-p0c6u8_pro_0000338257-5 3 10 enzyme enzyme neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-VI isg17-p0c6u8_pro_0000338257-1 3 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-II The given accession number for Sheep ISG15 AF152103.1, actually corresponds to ISG17 isg17-k9n638_pro_0000422456-1 3 8 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-II The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain The given accession number for Sheep ISG15 AF152103.1, actually corresponds to ISG17 MERS PLpro exhibited weak enzymatic activity k9n638_pro_0000422456-l5lc70_myods-1 3 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-VII The accession number provided by the authors AFS88944.1, mapped between 1831-1951 of K9N638, which is equivalent to 978-1099 in PRO_0000422456 chain l5lc70_myods-p0c6u8_pro_0000338257-1 3 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 2-VII isg15-p0c6u8_pro_0000338257-3 1 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (top panel), Table 2 isg15-k9n638_pro_0000422456-4 1 5 unspecified role unspecified role neutral component neutral component purified purified PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (bottom panel), Table 2 isg17-p0c6u8_pro_0000338257-2 1 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (top panel), Table 2 The given accession number for Sheep ISG15 AF152103.1, actually corresponds to ISG17 isg15-p0c6u8_pro_0000338257-6 1 6 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (top panel), Table 2 isg17-k9n638_pro_0000422456-2 1 8 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (bottom panel), Table 2 The given accession number for Sheep ISG15 AF152103.1, actually corresponds to ISG17 isg15-p0c6u8_pro_0000338257-7 1 13 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (top panel), Table 2 isg15-k9n638_pro_0000422456-5 1 13 unspecified role unspecified role neutral component neutral component purified purified c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component purified purified PLpro region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 3 (bottom panel), Table 2 isg15-p0c6u8_pro_0000338257-8 2 6 enzyme target enzyme target substrate substrate neutral component neutral component purified purified 7-amino-4-methylcoumarin fluorophore fluorophore c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 10 enzyme enzyme neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0C6U8-PRO_0000338257:p.Arg888Glu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R E Wed Sep 16 10:32:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0c6u8-pro_0000338257:p.Arg888Glu' P0C6U8-PRO_0000338257:p.Met930Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain M A Mon Sep 21 12:19:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0c6u8-pro_0000338257:p.Met930Ala' P0C6U8-PRO_0000338257:p.Gln954Glu mutation increasing rate mutation increasing interaction rate mutation increasing rate certain certain sequence position certain certain certain sequence position certain Q E Fri Sep 18 22:13:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p0c6u8-pro_0000338257:p.Gln954Glu' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 5c, Table 1 isg15-p0c6u8_pro_0000338257-9 4 10 unspecified role unspecified role neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 3 2.62Å Rwork: 0.191 Rfree: 0.25 isg15-p0c6u8_pro_0000338257-10 4 13 unspecified role unspecified role neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component purified purified binding region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 3 2.44Å Rwork: 0.192 Rfree: 0.267