IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity. SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Muramatsu T., Takemoto C., Kim YT., Wang H., Nishii W., Terada T., Shirouzu M., Yokoyama S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus tomonari.muramatsu@riken.jp,yokoyama@riken.jp Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay tag fluorescence tag visualisation by fluorescence tag fluorescence Muramatsu T., Takemoto C., Kim YT., Wang H., Nishii W., Terada T., Shirouzu M., Yokoyama S. Virus - Publications including interactions involving viral proteins The substrate is labelled with N-methyl-anthranilic acid (NMA), a fluorescent probe for peptide commonly used in the study of proteases. Conjugation of NMA via its amino group to a peptide substrate results in quenching of the fluorescent signal. Upon enzymatic cleavage of the peptide by proteases, NMA is released and its fluorescence can be used to quantify enzyme activity. tomonari.muramatsu@riken.jp,yokoyama@riken.jp Accepted 2020-MAY-18 AT 09:38 BST AT 09:38 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity. SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Muramatsu T., Takemoto C., Kim YT., Wang H., Nishii W., Terada T., Shirouzu M., Yokoyama S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus tomonari.muramatsu@riken.jp,yokoyama@riken.jp Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Muramatsu T., Takemoto C., Kim YT., Wang H., Nishii W., Terada T., Shirouzu M., Yokoyama S. Virus - Publications including interactions involving viral proteins The protein had been synthesised in E. coli cell-free protein synthesis system tomonari.muramatsu@riken.jp,yokoyama@riken.jp Accepted 2020-MAY-18 AT 09:38 BST AT 09:38 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity. SARS-CoV 3CL protease cleaves its C-terminal autoprocessing site by novel subsite cooperativity. Proceedings of the National Academy of Sciences of the United States of America 2016 imex curation Muramatsu T., Takemoto C., Kim YT., Wang H., Nishii W., Terada T., Shirouzu M., Yokoyama S. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus tomonari.muramatsu@riken.jp,yokoyama@riken.jp Only protein-protein interactions imex curation in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Muramatsu T., Takemoto C., Kim YT., Wang H., Nishii W., Terada T., Shirouzu M., Yokoyama S. Virus - Publications including interactions involving viral proteins I had considered separate interactions for mutations in enzyme and substrate; because it was difficult to combine all of them tomonari.muramatsu@riken.jp,yokoyama@riken.jp Accepted 2020-MAY-18 AT 09:38 BST AT 09:38 BST by PPORRAS Proceedings of the National Academy of Sciences of the United States of America 2016 Only protein-protein interactions imex curation imex curation vtfq peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VTFQ p0c6u8-pro_0000338259 3C-like proteinase nsp5 ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ 3241 3546 8A3486F9E1A9A89D vtaq peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VTAQ nma-tsavlqsgfrk-dnp-nh2 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) TSAVLQSGFRK vtlq peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VTLQ r1a_sars Replicase polyprotein 1a ORF1a polyprotein 1a protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDLLEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLDQALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNGFAV DIP protein P0C6U8 original sequence version: 20 E1F65D5FD5DFF828 r1a_cvhsa-1 2 9 unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0C6U8:p.Cys3385Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 16:54:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3385Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1a-c, S1a, Table S1 2.2Å Rwork: 0.206 Rfree: 0.254 r1a_cvhsa-2 2 5 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Table S1, Figures 1, S1a 1.7Å Rwork: 0.194 Rfree: 0.221 nma_tsavlqsgfrk_dnp_nh2-r1a_cvhsa-1 1 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified P0C6U8:p.Cys3385Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 20:24:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3385Ala' 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Table 2 nma_tsavlqsgfrk_dnp_nh2-r1a_cvhsa-2 1 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0C6U8:p.Cys3385Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 19:50:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3385Ala' n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 4 inhibitor inhibitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) protein cleavage protein cleavage Table 2 nma_tsavlqsgfrk_dnp_nh2-r1a_cvhsa-3 1 8 inhibitor inhibitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified P0C6U8:p.Cys3385Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 16:18:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3385Ala' 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Table 2 nma_tsavlqsgfrk_dnp_nh2-r1a_cvhsa-4 1 6 inhibitor inhibitor neutral component neutral component purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme target enzyme target substrate substrate neutral component neutral component purified purified n-terminus fluorophore fluorophore n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 9 enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified P0C6U8:p.Cys3385Ala mutation mutation certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 16:24:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3385Ala' 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Table 2 r1a_cvhsa-r1a_cvhsa-1 3 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 16:07:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 17:10:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 20:16:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 20:08:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component purified purified 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0C6U8:p.Gln3546Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Q N Tue Jun 30 17:52:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln3546Asn' c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-e, S4-3 r1a_cvhsa-r1a_cvhsa-2 3 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 15:57:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 16:21:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 16:28:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 15:50:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component purified purified 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P0C6U8:p.Gln3240Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Q N Mon Jun 29 10:31:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln3231Asn' Tue Jun 30 17:45:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln3240Asn' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-b, S4-2 p0c6u8_pro_0000338259-r1a_cvhsa-4 3 5 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 16:30:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 15:46:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 15:46:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 19:37:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-e, S4-1 r1a_cvhsa-r1a_cvhsa-4 3 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 16:23:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 20:23:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 18:33:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 16:43:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component purified purified n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.[Gln3240Asn;Gln3546Asn] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Q N certain certain sequence position certain certain certain sequence position certain Q N Tue Jun 30 18:07:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln3240Asn;Gln3546Asn]' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-e, S4-4 p0c6u8_pro_0000338259-r1a_cvhsa-1 3 5 enzyme enzyme neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified P0C6U8:p.Phe3545Leu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F L Tue Jun 30 20:17:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3545Leu' P0C6U8:p.[Phe3545Leu;Phe3549Ala] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 18:51:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Phe3549Ala]' P0C6U8:p.[Phe3545Leu;Phe3549Asn] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 16:36:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Phe3549Asn]' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 18:18:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 15:53:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 17:40:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 18:43:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-e, S4-5 p0c6u8_pro_0000338259-r1a_cvhsa-2 3 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified P0C6U8:p.Phe3545Leu mutation mutation certain certain sequence position certain certain certain sequence position certain F L Tue Jun 30 18:41:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3545Leu' P0C6U8:p.[Phe3545Leu;Phe3549Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 17:02:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Phe3549Ala]' P0C6U8:p.[Phe3545Leu;Phe3549Asn] mutation mutation certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 16:33:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Phe3549Asn]' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 19:20:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 17:53:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 18:05:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 19:50:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) 5 enzyme enzyme neutral component neutral component purified purified P0C6U8-PRO_0000338259:p.Phe305Leu mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F L Tue Jun 30 19:41:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe305Leu' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-e, S4-6 r1a_cvhsa-r1a_cvhsa-3 3 9 enzyme enzyme neutral component neutral component purified purified 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0C6U8:p.Gln3546Asn mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain Q N Tue Jun 30 19:16:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln3546Asn' P0C6U8:p.[Phe3545Leu;Gln3546Asn] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain Q N Tue Jun 30 17:59:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Gln3546Asn]' ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified P0C6U8:p.Phe3545Leu mutation mutation certain certain sequence position certain certain certain sequence position certain F L Tue Jun 30 17:09:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3545Leu' P0C6U8:p.[Phe3545Leu;Phe3549Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 19:17:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Phe3549Ala]' P0C6U8:p.[Phe3545Leu;Phe3549Asn] mutation mutation certain certain sequence position certain certain certain sequence position certain F L certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 17:40:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe3545Leu;Phe3549Asn]' region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Phe3549Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 19:13:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Asn' P0C6U8:p.Phe3549Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 17:10:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3549Ala' P0C6U8:p.Phe3243Ala mutation mutation certain certain sequence position certain certain certain sequence position certain F A Tue Jun 30 18:35:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Ala' P0C6U8:p.Phe3243Asn mutation mutation certain certain sequence position certain certain certain sequence position certain F N Tue Jun 30 18:48:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe3243Asn' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Figs. 2a-e, S4-7, S4-8 r1a_cvhsa-r1a_cvhsa-5 3 9 enzyme target enzyme target substrate substrate neutral component neutral component in vitro translated in vitro translated protein in vitro translated purified purified region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 enzyme enzyme neutral component neutral component purified purified n-terminus s tag s tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 3CLpro proform sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P0C6U8:p.Cys3385Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain C A Tue Jun 30 17:15:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys3385Ala' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. S4-0 Cys3385Ala (C145A) is a cleavage-defective active-site mutation