HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html FKBP8 interact with classical swine fever virus NS5A protein and promote virus RNA replication. FKBP8 interact with classical swine fever virus NS5A protein and promote virus RNA replication. Virus genes 2016 imex curation Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com Accepted 2016-SEP-16 AT 08:55 BST AT 08:55 BST by ORCHARD Virus genes 2016 imex curation FKBP8 interact with classical swine fever virus NS5A protein and promote virus RNA replication. FKBP8 interact with classical swine fever virus NS5A protein and promote virus RNA replication. Virus genes 2016 imex curation Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com Accepted 2016-SEP-16 AT 08:55 BST AT 08:55 BST by ORCHARD Virus genes 2016 imex curation FKBP8 interact with classical swine fever virus NS5A protein and promote virus RNA replication. FKBP8 interact with classical swine fever virus NS5A protein and promote virus RNA replication. Virus genes 2016 imex curation Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Li H., Zhang C., Cui H., Guo K., Wang F., Zhao T., Liang W., Lv Q., Zhang Y. Virus - Publications including interactions involving viral proteins zcc87051007@126.com Accepted 2016-SEP-16 AT 08:55 BST AT 08:55 BST by ORCHARD Virus genes 2016 imex curation p19712-pro_0000038060 Non-structural protein 5A protein protein CSFV Classical swine fever virus (strain Alfort) Hog cholera virus SSNYILELLYKFRDNIKSSVREIAISWAPAPFSCDWTPTDDRIGLPHENYLRVETKCPCGYRMKAVKNCAGELRLLEEGGSFLCRNKFGRGSQNYRVTKYYDDNLSEIKPVIRMEGHVELYYKGATIKLDFNNSKTVLATDKWEVDHSTLVRALKRYTGAGYRGAYLGEKPNHKHLIQRDCATITKDKVCFIKMKRGCAFTYDLSLHNLTRLIELVHKNNLEDREIPAVTVTTWLAYTFVNEDIGTIKPTFGEKVTPEKQEEVVLQPAVVVDTTDVAVTVVGETSTMTTGETPTTFTSLGSDSKVRQVLKLGVDDGQYPGPNQQRASLLEAIQGVDERPSVLILGSDKATSNRVKTAKNVKIYRSRDPLELREMMKRGKILVVALSRVDTALLKFVDYKGTFLTRETLEALSLGKPKKRDITKAEAQWLLRLEDQIEELPDWFAAKEPIFLEANIKRDKYHLVGDIATIKEKAKQLGATDSTKISKEVGAKVYSMKL 2684 3180 4B36BE76BA5A5EAF f1s912_pig Peptidylprolyl isomerase FKBP8 protein protein pig Sus scrofa (Pig) Pig MASCAEPSAAGPEPTAPPPTGAPPLEDFEVLDGVEDAEGEEEEEEEEEDLSELPPLEDVGQPPVEEAEQPGALAREFLAAMEPEPEPAPAPDEWLDILGNGLLRKKTLVPGPPGSSRPTKGQVVTVQLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKAAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEEQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN 988F6F28B8471D0A ns5a-fkbp8-8 1 4 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A fkbp8-1 1 4 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B ns5a-fkbp8-11 2 4 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 5 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 2 fkbp8-ns5a-13 3 5 unspecified role unspecified role neutral component neutral component purified purified RED tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component c terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. colocalization colocalization 3