IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phage display technique identifies the interaction of severe acute respiratory syndrome coronavirus open reading frame 6 protein with nuclear pore complex interacting protein NPIPB3 in modulating Type I interferon antagonism. Phage display technique identifies the interaction of severe acute respiratory syndrome coronavirus open reading frame 6 protein with nuclear pore complex interacting protein NPIPB3 in modulating Type I interferon antagonism. Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi 2017 imex curation Huang SH., Lee TY., Lin YJ., Wan L., Lai CH., Lin CW. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cwlin@mail.cmu.edu.tw Only protein-protein interactions imex curation human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells confocal microscopy confocal microscopy immunostaining immunostaining Huang SH., Lee TY., Lin YJ., Wan L., Lai CH., Lin CW. Virus - Publications including interactions involving viral proteins The original cell line HL-CZ, was contaminated and shown to be a K-562 derivative; (https://web.expasy.org/cellosaurus/CVCL_WU73); so we have used K-562 as host. cwlin@mail.cmu.edu.tw Accepted 2020-JUN-26 AT 14:32 BST AT 14:32 BST by MGT Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi 2017 Only protein-protein interactions imex curation imex curation Phage display technique identifies the interaction of severe acute respiratory syndrome coronavirus open reading frame 6 protein with nuclear pore complex interacting protein NPIPB3 in modulating Type I interferon antagonism. Phage display technique identifies the interaction of severe acute respiratory syndrome coronavirus open reading frame 6 protein with nuclear pore complex interacting protein NPIPB3 in modulating Type I interferon antagonism. Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi 2017 imex curation Huang SH., Lee TY., Lin YJ., Wan L., Lai CH., Lin CW. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cwlin@mail.cmu.edu.tw Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Huang SH., Lee TY., Lin YJ., Wan L., Lai CH., Lin CW. Virus - Publications including interactions involving viral proteins cwlin@mail.cmu.edu.tw Accepted 2020-JUN-26 AT 14:32 BST AT 14:32 BST by MGT Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi 2017 Only protein-protein interactions imex curation imex curation Phage display technique identifies the interaction of severe acute respiratory syndrome coronavirus open reading frame 6 protein with nuclear pore complex interacting protein NPIPB3 in modulating Type I interferon antagonism. Phage display technique identifies the interaction of severe acute respiratory syndrome coronavirus open reading frame 6 protein with nuclear pore complex interacting protein NPIPB3 in modulating Type I interferon antagonism. Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi 2017 imex curation Huang SH., Lee TY., Lin YJ., Wan L., Lai CH., Lin CW. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus cwlin@mail.cmu.edu.tw Only protein-protein interactions imex curation in vitro In vitro phage display phage display nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Huang SH., Lee TY., Lin YJ., Wan L., Lai CH., Lin CW. Virus - Publications including interactions involving viral proteins The ORF6-interacting phage clone was randomly picked up from individual plaques, amplified in E. coli, and then used for determining the binding affinity to the recombinant ORF6 protein using direct enzyme-linked immunosorbent assay. The high affinity clones were subsequently sequenced. cwlin@mail.cmu.edu.tw Accepted 2020-JUN-26 AT 14:32 BST AT 14:32 BST by MGT human lung cDNA Journal of microbiology, immunology, and infection = Wei mian yu gan ran za zhi 2017 Only protein-protein interactions imex curation imex curation npib3_human Nuclear pore complex-interacting protein family member B3 NPIPB3 KIAA0220 NPIPL3 Nuclear pore complex-interacting protein-like 3 Protein pps22-1 protein protein human Homo sapiens Human MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLHVIIAFPTSYKVVITLWIVYLWVSLLKTIFWSRNGHDGSTDVQQRAWRSNRRRQEGLRSICMHTKKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINHHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKALCNWVRMAAAEHRHSSGLPYWPYLTAETLKNRMGHQPPPPTQQHSITDNSLSLKTPPECLLTPLPPSADDNLKTPPECVLTPLPPSADDNLKTPPECVLTPLPPSADDNLKTPPECLLTPLPPSADDNLKTPPECLLTPLPPSALPSAPPSADDNLKTRAECLLHPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTALPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQQMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQQMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGGRFHPQRMIISRHLPSVSSLPFHPQLHPQQMIISRHLPSVCGERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPSERQLTPLPPSAPPSADDNIKTPAERLRGPLPPSADDNLKTPPLATQEAEAEKPRKPKRQRAAEMEPPPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADVEPSSPEPKRRRVGDVEPSRKPKRRRAADVEPSLPEPKRRRLS 342657B7685C9167 rmxl2_human RNA-binding motif protein, X-linked-like-2 RBMXL2 HNRNPGT Testis-specific heterogeneous nuclear ribonucleoprotein G-T protein protein human Homo sapiens Human MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKAAARDMNGKSLDGKAIKVAQATKPAFESSRRGPPPPRSRGRPRFLRGTRGGGGGPRRSPSRGGPDDDGGYTADFDLRPSRAPMPMKRGPPPRRVGPPPKRAAPSGPARSSGGGMRGRALAVRGRDGYSGPPRREPLPPRRDPYLGPRDEGYSSRDGYSSRDYREPRGFAPSPGEYTHRDYGHSSVRDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY CE7B79EF3C64197B ccnl1_human Cyclin-L1 CCNL1 BM-001 UNQ530/PRO1073 protein protein human Homo sapiens Human MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIEEAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQEICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKAKGLNPDGTPALSTLGGFSPASKPSSPREVKAEEKSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSGTYSSRSRSRSRSHSESPRRHHNHGSPHLKAKHTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRHERGHHRDRRERSRSFERSHKSKHHGGSRSGHGRHRR 64C0CAEF54A3E9F9 ns6_sars ORF6 protein Accessory protein 6 Protein X3 6 Non-structural protein 6 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP npipb3-ns6_cvhsa-1 3 4 unspecified role unspecified role prey prey phage library phage library c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figs. 2, 3 ns6_cvhsa-ccnl1-1 3 6 unspecified role unspecified role prey prey phage library phage library 7 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figs. 2, 3 ns6_cvhsa-rbmxl2-1 3 5 unspecified role unspecified role prey prey phage library phage library 7 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Figs. 2, 3 npipb3-ns6_cvhsa-2 2 4 unspecified role unspecified role bait bait purified purified thioredoxin tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4 npipb3-ns6_cvhsa-3 1 7 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5