IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phenylalanine residues at the carboxyl terminus of the herpes simplex virus 1 UL20 membrane protein regulate cytoplasmic virion envelopment and infectious virus production. Phenylalanine residues at the carboxyl terminus of the herpes simplex virus 1 UL20 membrane protein regulate cytoplasmic virion envelopment and infectious virus production. J. Virol. (0022-538X) 2014 imex curation Charles A.S., Chouljenko V.N., Jambunathan N., Subramanian R., Mottram P., Kousoulas K.G. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. The Tax ID = 10298 (top level term) has been used for HSV-1 proteins as no info can be found for the VC-1 strain and there are no UniProt entries for the proteins in question for the F1 strain. vtgusk@lsu.edu 22-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions chlae-vero Chlorocebus (Cercopithecus) aethiops kidney cells Grivet vero Chlorocebus (Cercopithecus) aethiops kidney cells similar to cos-7 cells but these are not trasnformed pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Charles A.S., Chouljenko V.N., Jambunathan N., Subramanian R., Mottram P., Kousoulas K.G. Virus - Publications including interactions involving viral proteins UL37 -there are several entries for top level strain - i took top hit with same nos of aas as reference strain. The Tax ID = 10298 (top level term) has been used for HSV-1 proteins as no info can be found for the VC-1 strain and there are no UniProt entries for the proteins in question for the F1 strain. vtgusk@lsu.edu Accepted 2015-JAN-07 by ORCHARD J. Virol. (0022-538X) 2014 Only protein-protein interactions imex curation itp_hhv11 Inner tegument protein UL37 Viral deamidase UL37 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MADRGLPSEAPVVTTSPAGPPSDGPMQRLLASLAGLRQPPTPTAETANGADDPAFLATAKLRAAMAAFLLSGTAIAPADARDCWRPLLEHLCALHRAHGLPETALLAENLPGLLVHRLVVALPEAPDQAFREMEVIKDTILAVTGSDTSHALDSAGLRTAAALGPVRVRQCAVEWIDRWQTVTKSCLAMSPRTSIEALGETSLKMAPVPLGQPSANLTTPAYSLLFPAPFVQEGLRFLALVSNRVTLFSAHLQRIDDATLTPLTRALFTLALVDEYLTTPERGAVVPPPLLAQFQHTVREIDPAIMIPPLEANKMVRSREEVRVSTALSRVSPRSACAPPGTLMARVRTDVAVFDPDVPFLSSSALAVFQPAVSSLLQLGEQPSAGAQQRLLALLQQTWTLIQNTNSPSVVINTLIDAGFTPSHCTHYLSALEGFLAAGVPARTPTGHGLGEVQQLFGCIALAGSNVFGLAREYGYYANYVKTFRRVQGASEHTHGRLCEAVGLSGGVLSQTLARIMGPAVPTEHLASLRRALVGEFETAERRFSSGQPSLLRETALIWIDVYGQTHWDITPTTPATPLSALLPVGQPSHAPSVHLAAATQIRFPALEGIHPNVLADPGFVPYVLALVVGDALRATCSAAYLPRPVEFALRVLAWARDFGLGYLPTVEGHRTKLGALITLLEPAARGGLGPTMQMADNIEQLLRELYVISRGAVEQLRPLVQLQPPPPPEVGTSLLLISMYALAARGVLQDLAERADPLIRQLEDAIVLLRLHMRTLSAFFECRFESDGRRLYAVVGDTPDRLGPWPPEAMGDAVSQYCSMYHDAKRALVASLASLRSVITETTAHLGVCDELAAQVSHEDNVLAVVRREIHGFLSVVSGIHARASKLLSGDQVPGFCFMGQFLARWRRLSACYQAARAAAGPEPVAEFVQELHDTWKGLQTERAVVVAPLVSSADQRAAAIREVMAHAPEDAPPQSPAADRVVLTSRRDLGAWGDYSLGPLGQTTAVPDSVDLSRQGLAVTLSMDWLLMNELLRVTDGVFRASAFRPLAGPESPRDLEVRDAGNSLPAPMPMDAQKPEAYGHGPRQADREGAPHSNTPVEDDEMIPEDTVAPPTDLPLTSYQ 18425792B4D7EC9D ul20_hhv11 Protein UL20 UL20 protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MTMRDDLPLVDRDLVDEAAFGGEEGELPLEEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKRVILFLWSFLVLKPLEMVAAGMYYGLTGRVVAPACILAAIVGYYVTWAVRALLLYVNIKRDRLPLSAPVFWGMSVFLGGTALCALFAAAHETFSPDGLFHFIATNQMLPPTDPLRTRALGIACAAGASMWVAAADSFAASANFFLARFWTRAILNAPVAF mint D10C373183E96218 gk_hhv11 Envelope glycoprotein K UL53 gK Syncytial protein protein protein hhv11 Human herpesvirus 1 (strain 17) (HHV-1) Human herpes simplex virus 1 HHV-1 MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPTGTNNDTALVWMKMNQTLLFLGAPTHPPNGGWRNHAHICYANLIAGRVVPFQVPPDAMNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVSPAHKMVAPATYLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYHRPAIGVIVGCELMLRFVAVGLIVGTAFISRGACAITYPLFLTITTWCFVSTIGLTELYCILRRGPAPKNADKAAAPGRSKGLSGVCGRCCSIILSGIAVRLCYIAVVAGVVLVALHYEQEIQRRLFDV mint DC69FE77084E84A1 ul20-ul37 1 3 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 8 Phenylalanine replacement or deletion of carboxyl-terminal regions of the UL20 protein caused drastic defects in virion envelopment without affecting colocalization of the UL20 mutant proteins with the UL37 protein. ul20-ul37-1 1 3 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction 8-2 Positive control