UniProt UniProt http://www.uniprot.org Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. J. Virol. (0022-538X) 2014 imex curation Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr Accepted 2016-AUG-04 AT 16:05 BST AT 16:05 BST by ORCHARD J. Virol. (0022-538X) 2014 IMEx imex curation Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. J. Virol. (0022-538X) 2014 imex curation Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr Accepted 2016-AUG-04 AT 16:05 BST AT 16:05 BST by ORCHARD J. Virol. (0022-538X) 2014 mimix curation imex curation Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. J. Virol. (0022-538X) 2014 imex curation Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr Accepted 2016-AUG-04 AT 16:05 BST AT 16:05 BST by ORCHARD J. Virol. (0022-538X) 2014 mimix curation imex curation Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. J. Virol. (0022-538X) 2014 imex curation Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr Accepted 2016-AUG-04 AT 16:05 BST AT 16:05 BST by ORCHARD J. Virol. (0022-538X) 2014 IMEx imex curation Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. Murine gammaherpesvirus 68 encoding open reading frame 11 targets TANK binding kinase 1 to negatively regulate the host type I interferon response. J. Virol. (0022-538X) 2014 imex curation Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. confocal microscopy confocal microscopy immunostaining immunostaining Kang H.R., Cheong W.C., Park J.E., Ryu S., Cho H.J., Youn H., Ahn J.H., Song M.J. Virus - Publications including interactions involving viral proteins Authors did not respond on e-mail. Origin of transfected TBK1 (stated: '...FLAG-TBK1 and TBK1 K38A ...from Kate Fitzgerald..'): Fitzgerald K described flag-TBK1 in 12692549 ('...pCDNA3-Flag-TBK1 and pCDNA3-Flag-TBK1(K38A) were from M. Nakanishi (Nagoya, Japan)..'; Nakanishi M described TBK1/NAK in 10783893 (including FLAG-NAK) ('..Molecular cloning of NAK from MDAH041 cells...') and MDAH041 are human fibroblasts accord 7667317. Origin of transfected IRF3 (stated: '... IRF3 and IIRF3-5D from Ren Sun and Genhong Cheng, University of California, Los Angeles...'): Sun R and Cheng G. used plasmids in 19218087 and descibe the origin: '..Murine IRF-3 and IRF-3(5D) were derived from the original pEBB-IRF-3 and pBabe-IRF-3(5D) (Doyle et al., 2002)...'. moonsong@korea.ac.kr Accepted 2016-AUG-04 AT 16:05 BST AT 16:05 BST by ORCHARD J. Virol. (0022-538X) 2014 mimix curation imex curation tbk1_human Serine/threonine-protein kinase TBK1 TBK1 NAK TANK-binding kinase 1 T2K NF-kappa-B-activating kinase protein protein human Homo sapiens Human MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPVSCSLSRGLQVLLTPVLANILEADQEKCWGFDQFFAETSDILHRMVIHVFSLQQMTAHKIYIHSYNTATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVVCYACRIASTLLLYQELMRKGIRWLIELIKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKINLEAAELGEISDIHTKLLRLSSSQGTIETSLQDIDSRLSPGGSLADAWAHQEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9UHD2 original sequence version: 116 DIP protein Q9UHD2 original sequence version: 120 DIP protein Q9UHD2 original sequence version: 79 DIP protein Q9UHD2 original sequence version: null B58E4FE1B502276D irf3_mouse Interferon regulatory factor 3 Irf3 protein protein mouse Mus musculus Mouse METPKPRILPWLVSQLDLGQLEGVAWLDESRTRFRIPWKHGLRQDAQMADFGIFQAWAEASGAYTPGKDKPDVSTWKRNFRSALNRKEVLRLAADNSKDPYDPHKVYEFVTPGARDFVHLGASPDTNGKSSLPHSQENLPKLFDGLILGPLKDEGSSDLAIVSDPSQQLPSPNVNNFLNPAPQENPLKQLLAEEQWEFEVTAFYRGRQVFQQTLFCPGGLRLVGSTADMTLPWQPVTLPDPEGFLTDKLVKEYVGQVLKGLGNGLALWQAGQCLWAQRLGHSHAFWALGEELLPDSGRGPDGEVHKDKDGAVFDLRPFVADLIAFMEGSGHSPRYTLWFCMGEMWPQDQPWVKRLVMVKVVPTCLKELLEMAREGGASSLKTVDLHISNSQPISLTSDQYKAYLQDLVEDMDFQATGNI DIP protein P70671 original sequence version: 63 DIP protein P70671 original sequence version: 84 DIP protein P70671 original sequence version: 78 mint homomint Mediates interferon-stimulated response element (ISRE) promoter activation. Functions as a molecular switch for antiviral activity. DsRNA generated during the course of an viral infection leads to IRF3 phosphorylation on the C-terminal serine/threonine cluster. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of genes under the control of ISRE. The complex binds to the IE and PRDIII regions on the IFN-alpha and IFN-beta promoters respectively. IRF-3 does not have any transcription activation domains 1FF67C4E0FC7F027 tbk1_mouse Serine/threonine-protein kinase TBK1 TANK-binding kinase 1 T2K Tbk1 protein protein mouse Mus musculus Mouse MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYLHPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITGKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFAETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLVLELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTGVVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVKVYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQEGTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSHFSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQKMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL DIP protein Q9WUN2 original sequence version: 53 DIP protein Q9WUN2 original sequence version: 101 DIP protein Q9WUN2 original sequence version: 100 DIP protein Q9WUN2 original sequence version: 93 978ADDE3061DACD1 o41932_mhv68 GAMMAHV.ORF11 11 ORF11 protein protein mhv68 Murid herpesvirus 4 (MuHV-4) Murine gammaherpesvirus 68 MAESHPWSGRPSSSPRRSSTFANYAWKHTIKPNRILIRNARPLVINFATDRLPIIKPVDQIILEDAGTVGSALNLPSESICTRPGLLLFGHYNNDVPVTPLVDFKPDEPLQVVLTAHKTIVVPPGEFVMIIVCVNFEKIKSLDLIIHEMSTSNIPLPPTCGQTFKNFNTATPSLEIYGDVIECNDDQKTCVFTAVFPGLHRRCSLHGPLNFMGFVNSVNITGTILRVYYSGVSEAAPDSILVKFKTSSAVAFSKNPCQGHVPSHDDTLIPLVYTGPTLRLLPLETISIPFNTSFVAQNPDLKAIIYDNNLKDIRISATMWTGEQTPILAHNLTAAVKLIHSGTVFARAAFFSTKENKKACTLKLCPSTILLPGGELSLDTSTLPNCFK 8E018E3C4495280C gammahv_orf11-tbk1-1 2 8 unspecified role unspecified role prey prey cell lysate cell lysate 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5F gammahv_orf11-tbk1-2 3 9 unspecified role unspecified role bait bait infection infection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 6E gammahv_orf11-tbk1-4 5 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component infection infection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 6F tbk1-gammahv.orf11-1 4 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5D and I tbk1-gammahv.orf11-2 4 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UHD2:p.Lys38Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A kinase null mutant Wed May 02 19:37:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 18:27:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5G tbk1-gammahv.orf11-3 1 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5D irf3-irf3-5 4 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7B TBK1 (human FLAG-TBK1 cotransfected) Murine gammaherpesvirus 68 ORF11 (FLAG-ORF11 co-transfected) irf3-tbk1-3 4 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 7D Murine gammaherpesvirus 68 ORF11 (HA-ORF11 co-transfected) tbk1-gammahv.orf11-4 4 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined protein_kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 51 54 physical association physical association 8A and B, 9B