UniProt UniProt http://www.uniprot.org NF-κB signalling is attenuated by the E7 protein from cutaneous human papillomaviruses. NF-κB signalling is attenuated by the E7 protein from cutaneous human papillomaviruses. Virus Res. (0168-1702) 2012 imex curation Byg L.M., Vidlund J., Vasiljevic N., Clausen D., Forslund O., Norrild B. Virus - Publications including interactions involving viral proteins bodilnorrild@sund.ku.dk 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Byg L.M., Vidlund J., Vasiljevic N., Clausen D., Forslund O., Norrild B. Virus - Publications including interactions involving viral proteins bodilnorrild@sund.ku.dk Accepted 2014-AUG-21 by ORCHARD Virus Res. (0168-1702) 2012 imex curation q6ty35_9papi Protein E7 E7 protein protein human papillomavirus type 93 human papillomavirus type 93 MIGKEVTLQDIVLGLTPPEPVALNCEEELPTEQDTEEEPARTAFKIIVFCGGGCGSRLRIFVAATEFGVRCFQQLLVKELDLLCPNCRNSDLQHGGQ 670BEA5F3615ED9C ikka_human Inhibitor of nuclear factor kappa-B kinase subunit alpha CHUK IKKA TCF16 I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Transcription factor 16 protein protein human Homo sapiens Human MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE DIP protein O15111 original sequence version: 91 DIP protein O15111 original sequence version: 123 DIP protein O15111 original sequence version: 133 DIP protein O15111 original sequence version: 118 DIP protein O15111 original sequence version: 125 DIP protein O15111 original sequence version: 96 4EA55C6FFC66FA16 ve7_hpv04 Protein E7 E7 protein protein hpv04 Human papillomavirus type 4 MRGAAPTVADLNLELNDLVLPANLLSEEVLQSSDDEYEITEEESVVPFRIDTCCYRCEVAVRITLYAAELGLRTLEQLLVEGKLTFCCTACARSLNRNGR 17B2645A539FB35E ve7_hpv38 Protein E7 E7 protein protein hpv38 Human papillomavirus type 38 MIGKQATLRDIVLEELVQPIDLHCHEELPDLPEDIEASVVEEEPAYTPYKIIVLCGGCEVRLKLYVWATDAGIRNLQDCLLGDVRLLCPTCREDIRNGGR CE6F5E14A8E8978D ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP DIP protein P03129 original sequence version: 96 9BD612534CD2C9EB ve7_hpv20 Protein E7 E7 protein protein hpv20 Human papillomavirus type 20 MIGKEVTLQDIVLELNELQPEVQPVDLFCEEELPNEQQEREEEPQIERASYKVVAPCGCCKVKLRIFISATEFAIRSFQQLLIDELQLLCPDCRGNCKHGGS 24F9BDDC896CAD45 ve7_hpv37 Protein E7 E7 protein protein hpv37 Human papillomavirus type 37 MIGKEATIPEIVLELQELVQPTADLHCYEELSEEETEEERPHIPYKIVAPCCFCGSKLRLIVVATPIGIRSQEELLLGEVQLVCPNCRGKLRHD BE61F081950FFA7A q8b5b5_9papi Protein E7 E7 protein protein human papillomavirus type 92 human papillomavirus type 92 MIGKQATIPDIVLDLQDLVQPIDLHCDEDLSENQEEEPAPQRIDYKIVSSCGGCGIKLRIFASCTQFGIRTLQDLLLEEIALLCPDCKNGR 199BC373C9279DA1 q6ty28_9papi Protein E7 E7 protein protein human papillomavirus type 96 human papillomavirus type 96 MIGKEATIPDIKLELQDLVLPIDLHCDEELTEEQSENLSESTVAEVEPQRTLYKIVVPCGGCDSRLKIYVSATQFGIRSLEDLLLEEPSLLCPACRNGR 0B8DF8B38C1ED4CE q6ty35-chuk 1 2 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1B e7-chuk 1 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B e7-chuk-2 1 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1B e7-chuk-3 1 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1B q6ty28-chuk 1 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B q8b5b5-chuk 1 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1B e7-chuk-4 1 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1B e7-chuk-5 1 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B q6ty35-chuk-1 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C e7-chuk-6 1 8 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1C q6ty28-chuk-1 1 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association 1C e7-chuk-7 1 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association 1C e7-chuk-8 1 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association 1C q8b5b5-chuk-1 1 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association 1C