HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. J. Virol. (0022-538X) 2012 imex curation Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells confocal microscopy confocal microscopy immunostaining immunostaining Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 imex curation Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. J. Virol. (0022-538X) 2012 imex curation Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy immunostaining immunostaining Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 imex curation Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. J. Virol. (0022-538X) 2012 imex curation Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293a Homo sapiens hek293a hek293a bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 imex curation Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. Annexin A2 is involved in the formation of hepatitis C virus replication complex on the lipid raft. J. Virol. (0022-538X) 2012 imex curation Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins michlai@gate.sinica.edu.tw 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Saxena V., Lai C.K., Chao T.C., Jeng K.S., Lai M.M. Virus - Publications including interactions involving viral proteins As full detail of strain/isolate are not given, the UniProt HCV reference strain has been sued throughout. michlai@gate.sinica.edu.tw Accepted 2013-NOV-07 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2012 imex curation cav2_human Caveolin-2 CAV2 protein protein human Homo sapiens Human MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD DIP protein P51636 original sequence version: 131 89FDEDA861330B87 ns3_ns4a_hcvco Serine protease NS3/Non-structural protein 4A protein protein hcvco Hepatitis C virus genotype 1b (isolate Con1) (HCV) p27958-pro_0000037577 RNA-directed RNA polymerase protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRKKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLAPPHSAKSKFGYGAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGLSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCRASRVLTTSCGNTLTRYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRAWSVRARLLARGGKAAICGKYLFNWAVRTKLKLTPITAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 2F89B19E29A81A02 anxa2_human Annexin A2 ANXA2 ANX2 ANX2L4 CAL1H LPC2D Annexin-2 Annexin II Lipocortin II Calpactin I heavy chain Chromobindin-8 p36 Protein I Placental anticoagulant protein IV Calpactin-1 heavy chain protein protein human Homo sapiens Human MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD 5126E1337A0CBEA1 q99ib8-pro_0000045602 Non-structural protein 5A protein protein hcvjf Hepatitis C virus genotype 2a (isolate JFH-1) HCV SGSWLRDVWDWVCTILTDFKNWLTSKLFPKLPGLPFISCQKGYKGVWAGTGIMTTRCPCGANISGNVRLGSMRITGPKTCMNTWQGTFPINCYTEGQCAPKPPTNYKTAIWRVAASEYAEVTQHGSYSYVTGLTTDNLKIPCQLPSPEFFSWVDGVQIHRFAPTPKPFFRDEVSFCVGLNSYAVGSQLPCEPEPDADVLRSMLTDPPHITAETAARRLARGSPPSEASSSVSQLSAPSLRATCTTHSNTYDVDMVDANLLMEGGVAQTEPESRVPVLDFLEPMAEEESDLEPSIPSECMLPRSGFPRALPAWARPDYNPPLVESWRRPDYQPPTVAGCALPPPKKAPTPPPRRRRTVGLSESTISEALQQLAIKTFGQPPSSGDAGSSTGAGAAESGGPTSPGEPAPSETGSASSMPPLEGEPGDPDLESDQVELQPPPQGGGVAPGSGSGSWSTCSEEDDTTVCC 1977 2442 0BDEA498491643D8 p27958-pro_0000037575 Non-structural protein 4B protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SQHLPYIEQGMMLAEQFKQKALGLLQTASRHAEVITPAVQTNWQKLEVFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTGQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAALDSVGLGKVLVDILAGYGAGVAGALVAFKIMSGEVPSTEDLVNLLPAILSPGALAVGVVFASILRRRVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTAILSSLTVTQLLRRLHQWISSECTTPC 1712 1972 9BDA1D19BD9A0A17 ns3/4a-anxa2-1 4 NS3/4A 6 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Anxa2 8 unspecified role unspecified role bait bait physical association physical association Fig. 4A anxa2-ns4b-2 4 Anxa2 8 unspecified role unspecified role bait bait NS4B 10 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A anxa2-ns5a-2 4 Anxa2 8 unspecified role unspecified role bait bait NS5A 9 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4A anxa2-ns5b-1 4 NS5B 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Anxa2 8 unspecified role unspecified role bait bait physical association physical association Fig. 4A anxa2-ns5a-3 1 NS5A 9 unspecified role unspecified role neutral component neutral component Anxa2 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4C anxa2-ns4b-1 1 Anxa2 8 unspecified role unspecified role neutral component neutral component NS4B 10 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4B anxa2-ns5a-1 2 Anxa2 8 unspecified role unspecified role neutral component neutral component NS5A 9 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 5B and 5C anxa2-ns5a-4 3 NS5A 9 unspecified role unspecified role unspecified role unspecified role cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Anxa2 8 unspecified role unspecified role unspecified role unspecified role ncerulean tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6A ns5a-cav2-1 3 NS5A 9 unspecified role unspecified role unspecified role unspecified role cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Cav2 5 unspecified role unspecified role unspecified role unspecified role c-venus c-venus c-venus undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6B anxa2-cav2-ns5a-1 1 Anxa2 8 unspecified role unspecified role neutral component neutral component Cav2 5 unspecified role unspecified role neutral component neutral component c-venus c-venus c-venus undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5A 9 unspecified role unspecified role neutral component neutral component cfp bifc tag bifc tag bifc tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 6C