IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. Molecular biology of the cell 2010 imex curation Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bnal@hku.hk Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins bnal@hku.hk Accepted 2020-JUN-11 AT 13:12 BST AT 13:12 BST by LIVIAP Molecular biology of the cell 2010 Only protein-protein interactions imex curation imex curation The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. Molecular biology of the cell 2010 imex curation Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bnal@hku.hk Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins Myc-CRB3 construct was found to be of human origin from back referenced pmid 12527193 bnal@hku.hk Accepted 2020-JUN-11 AT 13:12 BST AT 13:12 BST by LIVIAP Molecular biology of the cell 2010 Only protein-protein interactions imex curation imex curation The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. Molecular biology of the cell 2010 imex curation Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bnal@hku.hk Only protein-protein interactions imex curation chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins bnal@hku.hk Accepted 2020-JUN-11 AT 13:12 BST AT 13:12 BST by LIVIAP Molecular biology of the cell 2010 Only protein-protein interactions imex curation imex curation The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. Molecular biology of the cell 2010 imex curation Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bnal@hku.hk Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins bnal@hku.hk Accepted 2020-JUN-11 AT 13:12 BST AT 13:12 BST by LIVIAP Molecular biology of the cell 2010 Only protein-protein interactions imex curation imex curation The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. The SARS coronavirus E protein interacts with PALS1 and alters tight junction formation and epithelial morphogenesis. Molecular biology of the cell 2010 imex curation Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus bnal@hku.hk Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Teoh KT., Siu YL., Chan WL., Schlüter MA., Liu CJ., Peiris JS., Bruzzone R., Margolis B., Nal B. Virus - Publications including interactions involving viral proteins bnal@hku.hk Accepted 2020-JUN-11 AT 13:12 BST AT 13:12 BST by LIVIAP human placenta cDNA library Molecular biology of the cell 2010 Only protein-protein interactions imex curation imex curation vemp_sars Envelope small membrane protein E sM 4 protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV A6D9A31652DDA194 q9buf7-pro_0000021005 Protein crumbs homolog 3 CRB3 UNQ588/PRO1158 protein protein human Homo sapiens Human QIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI 27 120 BF7CE07EB2E98A5E crum3_human Protein crumbs homolog 3 CRB3 UNQ588/PRO1158 protein protein human Homo sapiens Human MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI F0CCDE3D91E7392D q8n3r9-1 Protein PALS1 PALS1 MAGUK p55 subfamily member 5 MPP5 Membrane protein, palmitoylated 5 Protein associated with Lin-7 1 protein protein human Homo sapiens Human MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLYNANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR mint A3B2CB594E0908CA e-mpp5-1 5 9 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed PDZ domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed CT domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1a-b e-mpp5-2 1 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed physical association physical association FIg. 1c e-mpp5-3 2 9 unspecified role unspecified role bait bait purified purified PDZ domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain PDZ domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate chlae-vero_e6 chlae-vero_e6 cells vero_e6 vero_e6 cell epithelium Epithelium [epithelial cells] physical association physical association Fig. 2b mpp5-e-1 2 9 unspecified role unspecified role bait bait purified purified PDZ domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PDZ domain-binding motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 4a crb3-mpp5-1 2 9 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PDZ region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 4c mpp5-crb3-1 2 9 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PDZ region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 competitor competitor competitor neutral component neutral component CT peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 4c mpp5-crb3-2 2 9 unspecified role unspecified role bait bait purified purified n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PDZ region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 competitor competitor competitor neutral component neutral component CT peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 4c mpp5-e-2 2 9 unspecified role unspecified role bait bait purified purified PDZ domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 competitor competitor competitor neutral component neutral component CT peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range PDZ domain-binding motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 4c mpp5-e-3 2 9 unspecified role unspecified role bait bait purified purified PDZ domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 competitor competitor competitor neutral component neutral component CT peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate PDZ domain-binding motif required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association Fig. 4c mpp5-e-4 4 9 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed p.Asp73_Val76del mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain DLLV . n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association FIg. 4b e-mpp5-5 3 9 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 immunostaining immunostaining tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Suppl Fig. S1