IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. J. Biol. Chem. (0021-9258) 2010 imex curation Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. lhhwang@ym.edu.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Virus - Publications including interactions involving viral proteins Sub clone (P1) of Huh7.5.1 cells, which were derived from Huh7.5 cells (a subclone of Huh7 cells). The P1 cell line stably carries the HCV subgenomic replicon pSGR-JFH1, whereas the parental Huh7.5.1 cell line does not. lhhwang@ym.edu.tw Accepted 2014-MAY-06 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. J. Biol. Chem. (0021-9258) 2010 imex curation Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. lhhwang@ym.edu.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Virus - Publications including interactions involving viral proteins Sub clone (P1) of Huh7.5.1 cells, which were derived from Huh7.5 cells (a subclone of Huh7 cells). The P1 cell line stably carries the HCV subgenomic replicon pSGR-JFH1, whereas the parental Huh7.5.1 cell line does not. lhhwang@ym.edu.tw Accepted 2014-MAY-06 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. J. Biol. Chem. (0021-9258) 2010 imex curation Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. lhhwang@ym.edu.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap sequence tag sequence tag identification sequence tag Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Virus - Publications including interactions involving viral proteins The protein "Hsp72" is stated to be Hsp70–1a and Hsp70–1b,(genes HSPA1A and HSPA1B), ID = UniProt P08107 (HSP71_HUMAN) - rather than Heat shock 70 kDa protein 2,(gene HSPA2) ID = UniProt P54652 (HSP72_HUMAN) lhhwang@ym.edu.tw Accepted 2014-MAY-06 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. J. Biol. Chem. (0021-9258) 2010 imex curation Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. lhhwang@ym.edu.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Virus - Publications including interactions involving viral proteins The protein "Hsp72" is stated to be Hsp70–1a and Hsp70–1b,(genes HSPA1A and HSPA1B), ID = UniProt P08107 (HSP71_HUMAN) - rather than Heat shock 70 kDa protein 2,(gene HSPA2) ID = UniProt P54652 (HSP72_HUMAN) lhhwang@ym.edu.tw Accepted 2014-MAY-06 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. J. Biol. Chem. (0021-9258) 2010 imex curation Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. lhhwang@ym.edu.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Virus - Publications including interactions involving viral proteins Sub clone (P1) of Huh7.5.1 cells, which were derived from Huh7.5 cells (a subclone of Huh7 cells). The P1 cell line stably carries the HCV subgenomic replicon pSGR-JFH1, whereas the parental Huh7.5.1 cell line does not. lhhwang@ym.edu.tw Accepted 2014-MAY-06 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. Heat shock protein 72 is associated with the hepatitis C virus replicase complex and enhances viral RNA replication. J. Biol. Chem. (0021-9258) 2010 imex curation Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Affinomics - Interactions curated for the Affinomics consortium. lhhwang@ym.edu.tw 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chen Y.J., Chen Y.H., Chow L.P., Tsai Y.H., Chen P.H., Huang C.Y., Chen W.T., Hwang L.H. Virus - Publications including interactions involving viral proteins Virus - Publications including interactions involving viral proteins The protein "Hsp72" is stated to be Hsp70–1a and Hsp70–1b,(genes HSPA1A and HSPA1B), ID = UniProt P08107 (HSP71_HUMAN) - rather than Heat shock 70 kDa protein 2,(gene HSPA2) ID = UniProt P54652 (HSP72_HUMAN) lhhwang@ym.edu.tw Accepted 2014-MAY-06 by ORCHARD J. Biol. Chem. (0021-9258) 2010 Only protein-protein interactions imex curation hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD 78F513118C96DE66 p29846-pro_0000037673 Serine protease/helicase NS3 protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) APITAYAQQTRGLFGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCINGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWHAPQGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPSGHVVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQAFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSALGIHAVAYYRGLDVSVIPASGNVVVVATDALMTGFTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTMPQDAVSRSQRRGRTSRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLTRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT 1027 1657 1FE62F2A45CEC719 p29846-pro_0000037676 Non-structural protein 5A protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) SGSWLRDVWDWICTVLADFKTWLQSKLLPRLPGVPFFSCQRGYKGVWRGDGIMQTTCPCGAQLTGHVKNGSMRIWGPKTCSNTWHGTFPINAYTTGPCTPSPAPNYSRALWRVAAEEYVEVRRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVSFQVGLNQYVVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLARGSPPSLASSSASQLSALSLKAACTTRHTPPDADLIEANLLWRQEMGGNITRVESENKVVILDSFDPLRAEEDEREVSVPAEILRKSRKFPPALPVWARPDYNPPLLEPWKDPDYVPPVVHGCPLPPVKAPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSESSAAGSGTATAPPDQPSDDGDAGSDVESCSSMPPLEGEPGDPDLSDGSWSTVSEEDGEGVICC 1973 2419 54B67374505CD7E1 p29846-pro_0000037677 RNA-directed RNA polymerase protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) SMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQKKVTIDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSARSKFGYGAKDVRNLSGKAINHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKSKKCPMGFSYDTRCFDSTVTESDIRVEESIYQCCDLAPEARQAIRSLTERLYIGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVCGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDLPQPEYDQELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWATARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGACYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRAWRHRARSVRAKLLSQGGRAATCGRYLFNWAVKTKLKLTPIPAASQLDLSKWFVAGYGGGDIYHSLSRARPRWFMLCLLLLSVGVGIYLLPNR 2420 3010 38EA1D73CAF7915F p29846-pro_0000037675 Non-structural protein 4B protein protein hcvtw Hepatitis C virus genotype 1b (isolate Taiwan) (HCV) ASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRTLEAFWANDMWNFISGIQYLAGLSTLPGNPAIASLMAFTASITSPLTTQSTLLFNILGGWVAAQLAPPGAASAFVGAGIAGAAVGSIGLGKVLVDMVAGYGAGVAGALVAFKVMSGEMPSTEDLVNLLPAILSPGALVVGVVCAAILRRHVDPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSGLTITQLLRRLHQWINEDCSTPC 1712 1972 DD4F16A79E8A9623 hsp7c_human Heat shock cognate 71 kDa protein HSPA8 HSC70 HSP73 HSPA10 Heat shock 70 kDa protein 8 Lipopolysaccharide-associated protein 1 protein protein human Homo sapiens Human MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD 9AA27B210730670C polg-hspa2 3 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association 1A polg-hspa2-1 3 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait n_terminus tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 1Ai Weak interaction, TAP-Flag-NS4B is stated to be a purification control. polg-hspa2-2 4 7 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range p_cluster_isdr_pkr_binding_domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association 2A, 3, 5A In cells containing NS5A deletion mutants D3, D4, and D5, the interaction was significantly reduced. have entered feature as binding-region rather than required to bind, as there is still some residual binding after deletion. hspa1a-polg 4 9 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B, 5A polg-hspa2-3 6 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2C p29846_pro-hspa1a 4 7 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A hspa1a-p29846_pro 4 7 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5A hspa1a-p29846_pro-1 4 8 unspecified role unspecified role prey prey n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5Ai p29846_pro-hspa1a-1 4 8 unspecified role unspecified role bait bait n_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5Ai hspa1a-p29846_pro-6 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey association association 5Bi p29846_pro-hspa1a-5 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait association association 6A Overexpression of Hsp72 significantly increased the amounts of NS3 and NS5B complexed with NS5A p29846_pro-hspa1a-4 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 6Ai not sure if this interaction should be here-?? p29846_pro-p29846_pro-2 5 7 unspecified role unspecified role neutral component neutral component c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 6Bi p29846_pro-hspa1a-7 5 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait proximity proximity close-contact colocalization neighbourhood interaction 6C Overexpression of Hsp72 significantly increased the signal.