IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. Immunobiology 2010 imex curation Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus moskjoedt@health.sdu.dk Only protein-protein interactions imex curation in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins moskjoedt@health.sdu.dk Accepted 2021-NOV-11 AT 08:37 GMT AT 08:37 GMT by ORCHARD Immunobiology 2010 Only protein-protein interactions imex curation imex curation MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. Immunobiology 2010 imex curation Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus moskjoedt@health.sdu.dk Only protein-protein interactions imex curation crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column experimental particp experimental participant identification experimental particp Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins moskjoedt@health.sdu.dk Accepted 2021-NOV-11 AT 08:37 GMT AT 08:37 GMT by ORCHARD Immunobiology 2010 Only protein-protein interactions imex curation imex curation MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. Immunobiology 2010 imex curation Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus moskjoedt@health.sdu.dk Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins moskjoedt@health.sdu.dk Accepted 2021-NOV-11 AT 08:37 GMT AT 08:37 GMT by ORCHARD Immunobiology 2010 Only protein-protein interactions imex curation imex curation MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. MBL-associated serine protease-3 circulates in high serum concentrations predominantly in complex with Ficolin-3 and regulates Ficolin-3 mediated complement activation. Immunobiology 2010 imex curation Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus moskjoedt@health.sdu.dk Only protein-protein interactions imex curation human-serum Homo sapiens serum Serum anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P., Skjoedt MO., Palarasah Y., Munthe-Fog L., Jie Ma Y., Weiss G., Skjodt K., Skjodt K., Koch C., Garred P. Virus - Publications including interactions involving viral proteins moskjoedt@health.sdu.dk Accepted 2021-NOV-11 AT 08:37 GMT AT 08:37 GMT by ORCHARD Immunobiology 2010 Only protein-protein interactions imex curation imex curation mbl2_human Mannose-binding protein C MBL2 COLEC1 MBL Collectin-1 MBP1 Mannan-binding protein Mannose-binding lectin protein protein human Homo sapiens Human MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI DIP protein P11226 original sequence version: 181 C1F2AAED46D0F774 p48740-2 Mannan-binding lectin serine protease 1 Mannose-binding protein-associated serine protease Ra-reactive factor serine protease p100 Serine protease 5 MASP-3 MASP1 CRARF CRARF1 PRSS5 Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 protein protein human Homo sapiens Human MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVER 09B5297A6C14283A fcn3_human Ficolin-3 FCN3 FCNH HAKA1 Collagen/fibrinogen domain-containing lectin 3 p35 Collagen/fibrinogen domain-containing protein 3 Hakata antigen protein protein human Homo sapiens Human MDLLWILPSLWLLLLGGPACLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR 5CB8A7D3668FA364 fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region D363029846CCB3C9 masp1-11 2 6 elisa enzyme linked immunosorbent assay ELISA ELISA elisa western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction 2 EDTA -CHEBI:42191 Ca2+ at a physiological concentration. masp1-mbl2-11 1 5 unspecified role unspecified role prey prey purified purified crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction 5A masp1-fcn2-1 1 8 unspecified role unspecified role prey prey purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction 5A masp1-fcn2-2 1 7 unspecified role unspecified role prey prey purified purified possible tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) 6 unspecified role unspecified role bait bait purified purified C-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho-dg44 crigr Chinese hamster Cricetulus barabensis griseus cho-dg44 CHO DG44 cell line (dhfr genes deleted) direct interaction direct interaction 5A masp1-fcn3-1 3 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level direct interaction direct interaction 5A (RHS) Ficolin-2 and MBL appear to be less associated to MASP-3. masp1-fcn3-2 4 7 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level direct interaction direct interaction 5B The MASP-3 specific mAb co-precipitated a very prominent Ficolin-3 band whereas a much weaker Ficolin-2 band and no MBL were apparent. masp1-fcn2-3 4 8 unspecified role unspecified role prey prey physiological level physiological level endogenous level endogenous endogenous endogenous level 6 unspecified role unspecified role bait bait physiological level physiological level endogenous level endogenous endogenous endogenous level direct interaction direct interaction 5B The MASP-3 specific mAb co-precipitated a very prominent Ficolin-3 band whereas a much weaker Ficolin-2 band and no MBL were apparent.