HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1. The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1. J. Virol. (0022-538X) 2009 imex curation Mohd-Ismail N.K., Deng L., Sukumaran S.K., Yu V.C., Hotta H., Tan Y.J. Virus - Publications including interactions involving viral proteins The virus is stated to be strain 1B, cloned in Singapore. However his strain cannot be found in either UniProt or NCBI taxonomy. UniProt entry Q91AU0 has been used for the Viral Polyprotein, as this is the only UniProt entry with !00% homology to the sequence shown in figure 1A. mcbtanyj@imcb.a-star.edu.sg 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mohd-Ismail N.K., Deng L., Sukumaran S.K., Yu V.C., Hotta H., Tan Y.J. Virus - Publications including interactions involving viral proteins The virus is stated to be strain 1B, cloned in Singapore. However his strain cannot be found in either UniProt or NCBI taxonomy. UniProt entry Q91AU0 has been used for the Viral Polyprotein, as this is the only UniProt entry with !00% homology to the sequence shown in figure 1A. mcbtanyj@imcb.a-star.edu.sg Accepted 2014-JUL-15 by MGT J. Virol. (0022-538X) 2009 imex curation The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1. The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1. J. Virol. (0022-538X) 2009 imex curation Mohd-Ismail N.K., Deng L., Sukumaran S.K., Yu V.C., Hotta H., Tan Y.J. Virus - Publications including interactions involving viral proteins The virus is stated to be strain 1B, cloned in Singapore. However his strain cannot be found in either UniProt or NCBI taxonomy. UniProt entry Q91AU0 has been used for the Viral Polyprotein, as this is the only UniProt entry with !00% homology to the sequence shown in figure 1A. mcbtanyj@imcb.a-star.edu.sg 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mohd-Ismail N.K., Deng L., Sukumaran S.K., Yu V.C., Hotta H., Tan Y.J. Virus - Publications including interactions involving viral proteins The virus is stated to be strain 1B, cloned in Singapore. However his strain cannot be found in either UniProt or NCBI taxonomy. UniProt entry Q91AU0 has been used for the Viral Polyprotein, as this is the only UniProt entry with !00% homology to the sequence shown in figure 1A. mcbtanyj@imcb.a-star.edu.sg Accepted 2014-JUL-15 by MGT J. Virol. (0022-538X) 2009 imex curation The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1. The hepatitis C virus core protein contains a BH3 domain that regulates apoptosis through specific interaction with human Mcl-1. J. Virol. (0022-538X) 2009 imex curation Mohd-Ismail N.K., Deng L., Sukumaran S.K., Yu V.C., Hotta H., Tan Y.J. Virus - Publications including interactions involving viral proteins The virus is stated to be strain 1B, cloned in Singapore. However his strain cannot be found in either UniProt or NCBI taxonomy. UniProt entry Q91AU0 has been used for the Viral Polyprotein, as this is the only UniProt entry with !00% homology to the sequence shown in figure 1A. mcbtanyj@imcb.a-star.edu.sg 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions human-huh-7.5 Human Huh-7.5 cells huh75 Huh-7.5 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Mohd-Ismail N.K., Deng L., Sukumaran S.K., Yu V.C., Hotta H., Tan Y.J. Virus - Publications including interactions involving viral proteins The virus is stated to be strain 1B, cloned in Singapore. However his strain cannot be found in either UniProt or NCBI taxonomy. UniProt entry Q91AU0 has been used for the Viral Polyprotein, as this is the only UniProt entry with !00% homology to the sequence shown in figure 1A. mcbtanyj@imcb.a-star.edu.sg Accepted 2014-JUL-15 by MGT J. Virol. (0022-538X) 2009 imex curation q91au0_9hepc Core protein precursor Mature core protein NS3 helicase NS3 protease Protease NS2 Serine protease/helicase NS3 Viroporin p7 Viroporin p70 p23 p56/58 Envelope glycoprotein E1 Envelope glycoprotein E2 Genome polyprotein Gp32 Hepacivirin NS1 NS3P NS5B Non-structural protein 4A Non-structural protein 4B Non-structural protein 5A RNA-directed RNA polymerase gp35 gp68 gp70 p21 p27 p68 p8 protein protein hepatitis c virus subtype 1b Hepatitis C virus subtype 1b MSTIPKPQRKTKRNTYRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKARRPEGWAWAQPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPIDPRRRSRNLGKVIDTLTCGFADLMGYIPLVGAPLGGAARALAHGVRVLEDGVNYATGNLPGCSFSIFLLALLSCLTIPASAYEVRNASGVYHVTNDCSNSSIVYEAADIIMHTPGCVPCVRENNSSRCWVALTPTLAARNLSVPTTTIRRHVDLLVGAAAFCSAMYVGDLCGSVLLVSQLFTLSPRQHETVQDCNCSLYPGHVTGHRMAWDMMMNWSPTTALVLSQILRIPQTIVDMVAGAHWGVLAGIAYYSMVGNWAKVLVVMLLFAGVDGHTQVMGGSQASTINTLTGIFSPGAKQKIQLINTNGSWHINRTALNCNDSLNTGFLAALFYTHSFNSSGCLERMASCRPIDKFDQGWGPITYDEGPDLDQRPYCWHYAPRSCGIVPASQVCGPVYCFTPSPVVVGTTDRTGAPTYRWGENETDVLILNNTRPPQGNWFGCTWMNSTGFTKTCGGPPCNIGGAGNNTLVCPTDCFRKHPEATYTKCGSGPWLTPRCMVDYPYRPWHYPCTVNFTIFKVRMYVGGVEHRLNAARNWTRGERCDLEDRDRSELSPLLLSTTEWQILPCSFTTLPALSTGLIHLHQNIVDVQYLYGIGSVVVSLVIKWEYVLLSFFLLADARVCACLWMMLLIAQAEAALENLVVLNAASVAGAHGILTFLVFFCAAWYIKGRLVPGAAYAFYGVWPLLLLLLALPPRAYAMDREMAASCGGAVFIGLVLLTLSPHYKVFLARLIWWLQYFTTRAEAILHVWVPPLNVRGGRDAVILLTCAVHPDLIFDITKLLLAVLGPLMVFLAGITRVPYFVRAQGLIRACALARKVAGGHYIQMALMKLAALTGTYLYDHLTPLRDWAHAGLRDLAVAVEPVVFSDMETKIITWGADTAACGDIILGLPVSARRGREILLGPADSLEGQGWRLLAPITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVFHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDNRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFIPVESMETTMRSPVFTDNSSPPAVPQTFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGTYMSKAYGVDPNIRTGVRTITTGAPITYSTYGKFLADGGCSGGAYDIIMCDECHSTDSTTVLGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEIALSNTGEIPFYGKAIPIETIKGGRHLIFCHSKKKCDELAAKLSGLGLNAVAYYRGLDVSVIPTSGDVVVVATDALMTGFTGDSDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRGGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKSLIRLKPTLHGPTPLLYRLGTVQSEITLTHPVTKYIMACMSADLEVVTSTWVLVSGVLAALAAYCLTTGSVVIVGRIILSGKPAVIPDREVLYREFDEMEECASHLPYIEQGMQLAEQFKQKALGLLQTATKQAEAAAPVVESKWRALEAFWAKHMWNFISGIQYLAGLSTLHGNPAIASLMAFTASITSPLTTQHTLLFNILGGWVAAQLAPPSAASAFVGAGIAGAAVGSIGLGKVLVDVLAGYGAGVAGALVAFKVMSGEVPSTEDLVNLLPAVLSPGALVVGVVCAAILRRHVGPGEGAVQWMNRLIAFASRGNHVSPTHYVPESDAAARVTQILSSLTVTQLLRRLHQWINEDCSTPCSGSWLRDVWDWICTVLTDFKTWLQSKLLPRLPGVPFFSCQRGYRGVWRGDGIMQTTCPCGAQISGHVKNGSMRIVGPRSCSNTWHGTFPINAYTTGPCTPAPAPNYSRALWRVAAEEYVEVTRVGDFHYVTGMTTDNVKCPCQVPAPEFFTEVDGVRLHRYAPACKPLLREEVTFQVGLNQYLVGSQLPCEPEPDVAVLTSMLTDPSHITAETAKRRLDRGSPPSLASSSASQLSAPSLKATCTTRHDSPDAGLIEANLLWRQEMGGNITRVESENKVVILDSFEPLRAEEDEREVSVPAEILRKSRKFPRAMPIWARPDYNPPLLESWKNPDYVPPVVHGCPLPPIKGPPIPPPRRKRTVVLTESTVSSALAELATKTFGSSGSSAVDSGTASAPPDQPSDNGDAGSDAESYSSMPPLEGEPGDPDLSDGSWSTVSEEASEDVVCCSMSYTWTGALITPCAAEESKLPINALSNSLLRHHNMVYATTSRSASQRQKKVTFDRLQVLDDHYRDVLKEMKAKASTVKAKLLSVEEACKLTPPHSAKSKFGYGAKDVRNLSSKAVNHIRSVWKDLLEDTETPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSTLPQAVMGSSYGFQYSPGQRVEFLVNAWKSKKSPMGFAYDTRCFDSTVTESDIRVEESIYQCCDLVPEARQAIRSLTERLYVGGPLTNSKGQNCGYRRCRASGVLTTSCGNTLTCYLKASAACRAAKLQDCTMLVCGDDLVVICESAGTQEDAASLRVFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDASGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMYAPTLWARMILMTHFFSILLAQEQLEKALDCQIYGAYYSIEPLDLPQIIERLHGLSAFSLHSYSPGEINRVASCLRKLGVPPLRAWRHRARSVRAKLLSQGGRAATCGKYLFNWAVKTKLKLTPIPAASQLDLSGWFVAGYGGGDIYHSLSRARPRWFMLCLPLLSVGVGINLLPNR 3D89304314F9F795 p26660-pro_0000037609 Mature core protein protein protein hcvj6 Hepatitis C virus genotype 2a (isolate HC-J6) (HCV) STNPKPQRKTKRNTNRRPQDVKFPGGGQIVGGVYLLPRRGPRLGVRATRKTSERSQPRGRRQPIPKDRRSTGKSWGKPGYPWPLYGNEGLGWAGWLLSPRGSRPSWGPNDPRHRSRNVGKVIDTLTCGFADLMGYIPVVGAPLGGVARALAHGVRVLEDGVNFATGNLPGCSFSIF 2 177 FD93ACCE946B173C mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F core-mcl1 1 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q91AU0:p.Leu126Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:45:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu126ala' Tue Jun 30 17:51:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu126Ala' Q91AU0:p.Val122Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:58:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val122ala' Tue Jun 30 15:59:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val122Ala' Q91AU0:p.Leu119Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:16:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu119ala' Tue Jun 30 16:20:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu119Ala' 6 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A and 7A core-mcl1-1 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3B, Supp figure 1. mcl1-p26660_pro 3 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey P26660-PRO_0000037609:p.Gly119Leu mutation mutation certain certain sequence position certain certain certain sequence position certain G L Wed May 02 19:14:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly119leu' Tue Jun 30 17:57:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly119Leu' physical association physical association 9G