HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Zinc binding in pestivirus N(pro) is required for interferon regulatory factor 3 interaction and degradation. Zinc binding in pestivirus N(pro) is required for interferon regulatory factor 3 interaction and degradation. Journal of molecular biology 2009 imex curation Szymanski MR., Fiebach AR., Tratschin JD., Gut M., Ramanujam VM., Gottipati K., Patel P., Ye M., Ruggli N., Choi KH. Virus - Publications including interactions involving viral proteins nicolas.ruggli@ivi.admin.ch 17-Oct-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Szymanski MR., Fiebach AR., Tratschin JD., Gut M., Ramanujam VM., Gottipati K., Patel P., Ye M., Ruggli N., Choi KH. Virus - Publications including interactions involving viral proteins nicolas.ruggli@ivi.admin.ch Accepted 2016-SEP-15 AT 08:53 BST AT 08:53 BST by ORCHARD Journal of molecular biology 2009 imex curation irf3_pig Interferon regulatory factor 3 IRF3 protein protein pig Sus scrofa (Pig) Pig MGTQKPRILPWLISQLNQGQLEGVAWLDEGHTRFRIPWKHGLRQDAQQEDFGIFQAWAEASGAYTPGKDKPDLPTWKRNFRSALNRKEALRLAEDHSKDPHDPHKIYEFVTSGVGDFPEPDTSLDLSGRYSTSDTHEDSLDKLLSGMDLASDAGPQSLTLALEQPPQLSLSPSVDAPASCPNLGVRENPLKQLLANDDEWEFQVTVFYRGCQVFQQTVCSPGGLRLVGSEAEDGTLAGQPVRLPDPAASLTDRGVADYVRRVLSCLGGGLALWRAGQWLWAQRLGHCHVYWAMGEELIPDSGHKPDGEVPKDREGGVFDLGPFIEDLIAFIEGSRRSPRYTLWFCMGQSWPQDEPWVKRLVMVKVVPMCLRALVDMARDGGASSLENTVDLHISNSHPLSLTSDQYKACLRDLVEDMDF 8B731861BE002284 p19712-pro_0000038050 N-terminal protease protein protein CSFV Classical swine fever virus (strain Alfort) Hog cholera virus MELNHFELLYKTSKQKPVGVEEPVYDTAGRPLFGNPSEVHPQSTLKLPHDRGRGDIRTTLRDLPRKGDCRSGNHLGPVSGIYIKPGPVYYQDYTGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCVDGCILLKLAKRGTPRTLKWIRNFTNCPLWVTSC 1 168 F2D196BB6A5F0F47 npro-irf3-3 1 3 unspecified role unspecified role unspecified role unspecified role P19712-PRO_0000038050:p.Cys112Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:23:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys112ala' Tue Jun 30 16:41:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys112Ala' P19712-PRO_0000038050:p.Cys134Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:43:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys134ala' Tue Jun 30 18:26:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys134Ala' P19712-PRO_0000038050:p.Cys138Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A Wed May 02 20:18:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys138ala' Tue Jun 30 18:00:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys138Ala' P19712-PRO_0000038050:p.Cys161Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:15:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys161ala' Tue Jun 30 19:37:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys161Ala' 2 unspecified role unspecified role unspecified role unspecified role physical association physical association 5A