IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Virology 2009 imex curation Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dxliu@imcb.a-star.edu.sg Only protein-protein interactions imex curation in vitro In vitro crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins Cross-linking agent: Glutaraldehyde (CHEBI:64276) dxliu@imcb.a-star.edu.sg Accepted 2020-JUN-19 AT 11:07 BST AT 11:07 BST by PPORRAS Virology 2009 Only protein-protein interactions imex curation imex curation Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Virology 2009 imex curation Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dxliu@imcb.a-star.edu.sg Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins dxliu@imcb.a-star.edu.sg Accepted 2020-JUN-19 AT 11:07 BST AT 11:07 BST by PPORRAS Virology 2009 Only protein-protein interactions imex curation imex curation Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Virology 2009 imex curation Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dxliu@imcb.a-star.edu.sg Only protein-protein interactions imex curation in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins With the help of https://www.bioinformatics.org/sms/rev_comp.html tool, the reverse-complement 3'UTR sequence was generated. dxliu@imcb.a-star.edu.sg Accepted 2020-JUN-19 AT 11:07 BST AT 11:07 BST by PPORRAS Virology 2009 Only protein-protein interactions imex curation imex curation Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Formation of stable homodimer via the C-terminal alpha-helical domain of coronavirus nonstructural protein 9 is critical for its function in viral replication. Virology 2009 imex curation Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dxliu@imcb.a-star.edu.sg Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Chen B., Fang S., Tam JP., Liu DX. Virus - Publications including interactions involving viral proteins dxliu@imcb.a-star.edu.sg Accepted 2020-JUN-19 AT 11:07 BST AT 11:07 BST by PPORRAS Virology 2009 Only protein-protein interactions imex curation imex curation aibv_rna_antisense_3'utr Avian infectious bronchitis virus-ssrna-antisense-3'UTR rna ribonucleic acid RNA rna aibv Avian infectious bronchitis virus-Beaudette strain TGCTCTAACTCTATACTAGCCTATAAATTTTAACTATACTTAGCCAATTAAACTTAACTTAAACTAAAATTTAGCTCTTCCCCTAATGGGCGTCCTAGTGCTGTACCCTCGATCGTACTCCGCGTGGCCCCGGCACTGGCATCTTTATACCTACTCTAAACTAACTTAAACTAAACTAAAAATTAAACTAAATTAAAATCTAAGGGTCTACCGTTCGTTTCCAGGCTACTAAGTAGACAGATTAGACATTTCCCTGGCGATAGACATGTAGGTAATCAAGCTACATGCCTATCTTCCTTAACTCTTACTATTGAATTTCTACGATAAAGCAAACTAATGAGAATCACAACAATAAAAAGCACAGCAACAATACAATAAGCAAAAAGCAACCAAAAGAAGCTTAAGTATTGAACATAATCACAATCAATGCCTGTAATAATTGATAGGAAAGCACAGAAATAGTGTTTAACAAAATGTACCAGGAAACAACAGGTCCATTATGTTACTCA p0c6v3-pro_0000338322 Non-structural protein 9 ORF1a polyprotein 1a protein protein ibvb ibvb IBV NNELMPHGVKTKACVAGVDQAHCSVESKCYYTNISGNSVVAAITSSNPNLKVASFLNEAGNQIYVDLDPPCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQ 3673 3783 2C408117DF15625B aibv_rna_3'utr Avian infectious bronchitis virus-ssrna-3'UTR rna ribonucleic acid RNA rna aibv Avian infectious bronchitis virus-Beaudette strain TGAGTAACATAATGGACCTGTTGTTTCCTGGTACATTTTGTTAAACACTATTTCTGTGCTTTCCTATCAATTATTACAGGCATTGATTGTGATTATGTTCAATACTTAAGCTTCTTTTGGTTGCTTTTTGCTTATTGTATTGTTGCTGTGCTTTTTATTGTTGTGATTCTCATTAGTTTGCTTTATCGTAGAAATTCAATAGTAAGAGTTAAGGAAGATAGGCATGTAGCTTGATTACCTACATGTCTATCGCCAGGGAAATGTCTAATCTGTCTACTTAGTAGCCTGGAAACGAACGGTAGACCCTTAGATTTTAATTTAGTTTAATTTTTAGTTTAGTTTAAGTTAGTTTAGAGTAGGTATAAAGATGCCAGTGCCGGGGCCACGCGGAGTACGATCGAGGGTACAGCACTAGGACGCCCATTAGGGGAAGAGCTAAATTTTAGTTTAAGTTAAGTTTAATTGGCTAAGTATAGTTAAAATTTATAGGCTAGTATAGAGTTAGAGCA pro_0000338322-1 1 6 unspecified role unspecified role neutral component neutral component purified purified P0C6V3-PRO_0000338322:p.Lys10Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:32:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys10Ala' P0C6V3-PRO_0000338322:p.Tyr31Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 18:18:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr31Ala' P0C6V3-PRO_0000338322:p.Lys51Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 15:52:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys51Ala' P0C6V3-PRO_0000338322:p.Lys90Ala mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:07:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys90Ala' P0C6V3-PRO_0000338322:p.Ile95Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 19:30:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 17:38:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' P0C6V3-PRO_0000338322:p.Ile95Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 18:32:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Ala' P0C6V3-PRO_0000338322:p.Gly98Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G A Tue Jun 30 19:26:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figs. 3a, 5a pro_0000338322-2 4 6 unspecified role unspecified role neutral component neutral component purified purified P0C6V3-PRO_0000338322:p.Lys51Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 17:20:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys51Ala' P0C6V3-PRO_0000338322:p.Lys90Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:23:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys90Ala' P0C6V3-PRO_0000338322:p.Lys10Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 18:11:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys10Ala' P0C6V3-PRO_0000338322:p.Tyr31Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 16:34:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr31Ala' P0C6V3-PRO_0000338322:p.Ile95Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 15:49:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 18:10:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figs. 3b, 5a pro_0000338322-pro_0000338322-1 2 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0C6V3-PRO_0000338322:p.Ile95Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 18:40:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 16:57:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3c aibv_rna_3'utr-pro_0000338322-1 3 6 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 19:04:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (middle panel lanes 1 and 2) aibv_rna_antisense_3'utr-pro_0000338322-1 3 6 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 18:23:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (bottom panel lanes 1 and 2) aibv_rna_3'utr-pro_0000338322-2 3 6 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Lys51Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:52:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys51Ala' P0C6V3-PRO_0000338322:p.Lys90Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:44:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys90Ala' P0C6V3-PRO_0000338322:p.Lys10Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 19:33:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys10Ala' P0C6V3-PRO_0000338322:p.Tyr31Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 16:36:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr31Ala' P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 19:23:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' P0C6V3-PRO_0000338322:p.Ile95Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 16:07:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Ile95Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 18:49:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Ala' P0C6V3-PRO_0000338322:p.Gly98Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Tue Jun 30 17:27:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Ala' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (middle panel lanes 3-8), Fig. 5b middle plane aibv_rna_3'utr-pro_0000338322-3 3 6 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Lys10Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain K A Tue Jun 30 16:22:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys10Ala' P0C6V3-PRO_0000338322:p.Ile95Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 15:58:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Ala' P0C6V3-PRO_0000338322:p.Gly98Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G A Tue Jun 30 18:13:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Ala' P0C6V3-PRO_0000338322:p.Ile95Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 17:59:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Tyr31Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain Y A Tue Jun 30 16:23:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr31Ala' P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Only weak interaction was observed Tue Jun 30 19:46:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (middle panel lanes 3-8), Fig. 5b middle panel Only weak interaction was observed for p.Gly98Asp mutant aibv_rna_antisense_3'utr-pro_0000338322-3 3 6 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Gly98Asp mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 19:27:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' P0C6V3-PRO_0000338322:p.Ile95Asn mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 18:27:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Gly98Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain G A Tue Jun 30 19:28:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Ala' P0C6V3-PRO_0000338322:p.Ile95Ala mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 18:36:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Ala' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (bottom panel lanes 3-8) aibv_rna_antisense_3'utr-pro_0000338322-4 3 6 unspecified role unspecified role prey prey purified purified P0C6V3-PRO_0000338322:p.Ile95Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I A Tue Jun 30 19:05:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Ala' P0C6V3-PRO_0000338322:p.Gly98Asp mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 17:35:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' P0C6V3-PRO_0000338322:p.Ile95Asn mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I N Tue Jun 30 16:19:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile95Asn' P0C6V3-PRO_0000338322:p.Gly98Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Tue Jun 30 19:52:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Ala' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (bottom panel lanes 3-8) aibv_rna_3'utr-pro_0000338322-4 3 6 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 15:52:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (middle panel lanes 1 and 2) aibv_rna_antisense_3'utr-pro_0000338322-5 3 6 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P0C6V3-PRO_0000338322:p.Gly98Asp mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain G D Tue Jun 30 16:52:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly98Asp' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait purified purified digoxigenin label dye labelled dye label dye labelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 4a (bottom panel lanes 1 and 2)