MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Pf3 coat protein contacts TM1 and TM3 of YidC during membrane biogenesis. The Pf3 coat protein contacts TM1 and TM3 of YidC during membrane biogenesis. FEBS Lett. (0014-5793) 2008 imex curation Klenner C., Yuan J., Dalbey RE., Kuhn A. Virus - Publications including interactions involving viral proteins suggested by aryamontri 2008-12-03 Only protein-protein interactions ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink predetermined predetermined participant predetermined Klenner C., Yuan J., Dalbey RE., Kuhn A. Virus - Publications including interactions involving viral proteins suggested by aryamontri FEBS Lett. (0014-5793) 2008 2008-12-03 Only protein-protein interactions imex curation capsd_bppf3 Capsid protein G8P Pf3 coat protein VIII Gene 8 protein Coat protein B Major coat protein protein protein bppf3 Pseudomonas phage Pf3 MQSVITDVTGQLTAVQADITTIGGAIIVLAAVVLGIRWIKAQFF mint 7534B6279983AF77 yidc_ecoli Membrane protein insertase YidC Foldase YidC Inner membrane protein YidC Membrane integrase YidC Oxa1Ec JW3683 b3705 yidC protein protein ecoli Escherichia coli (strain K12) MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKLISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGPDNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNVQNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIADNENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQTGAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIIIITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPLGGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQKMSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGLHSREKKKS 95EBC5DAB4F2FCFB viii-yidc 1 Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Tue Jul 12 10:05:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:14:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile27cys' Tue Jun 30 18:24:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile27Cys' range MINT-6795857: original sequence: 27-27 : ADITTIGGAIIVLAAVVLGI YidC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P25714:p.Ser16Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S C Tue Jul 12 10:05:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:24:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser16cys' Tue Jun 30 20:01:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser16Cys' range MINT-6795866: original sequence: 16-16 : NLLVIALLFVSFMIWQAWEQ binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TM1 disulfide bond disulfide bond disulfide bridge SS-bond F3 mint viii-yidc-1 1 Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Tue Jul 12 10:16:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:18:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile27cys' Tue Jun 30 17:18:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile27Cys' range MINT-6795879: original sequence: 27-27 : ADITTIGGAIIVLAAVVLGI YidC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TM3 P25714:p.Met430Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain M C Tue Jul 12 10:54:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:44:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met430cys' Tue Jun 30 19:00:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met430Cys' range MINT-6795873: original sequence: 430-430 : LGGCFPLLIQMPIFLALYYM disulfide bond disulfide bond disulfide bridge SS-bond F3 F4 F5 mint viii-viii 1 Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Tue Jul 12 10:16:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:28:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile27cys' Tue Jun 30 18:32:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile27Cys' range MINT-6795904: original sequence: 27-27 : ADITTIGGAIIVLAAVVLGI Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Tue Jul 12 10:16:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:43:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile27cys' Tue Jun 30 20:14:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile27Cys' range MINT-6795908: original sequence: 27-27 : ADITTIGGAIIVLAAVVLGI disulfide bond disulfide bond disulfide bridge SS-bond F3 mint viii-yidc-2 1 Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Val28Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V C Tue Jul 12 10:16:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:03:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val28cys' Tue Jun 30 19:37:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val28Cys' range MINT-6795922: original sequence: 28-28 : DITTIGGAIIVLAAVVLGIR YidC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TM1 P25714:p.Ser16Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain S C Tue Jul 12 10:54:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 20:25:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser16cys' Tue Jun 30 16:01:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser16Cys' range MINT-6795916: original sequence: 16-16 : NLLVIALLFVSFMIWQAWEQ disulfide bond disulfide bond disulfide bridge SS-bond F3 mint viii-yidc-3 1 Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Val28Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V C Tue Jul 12 10:17:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 18:24:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val28cys' Tue Jun 30 18:33:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val28Cys' range MINT-6795937: original sequence: 28-28 : DITTIGGAIIVLAAVVLGIR YidC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TM3 P25714:p.Met430Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain M C Tue Jul 12 10:17:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 15:57:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met430cys' Tue Jun 30 15:42:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met430Cys' range MINT-6795933: original sequence: 430-430 : LGGCFPLLIQMPIFLALYYM disulfide bond disulfide bond disulfide bridge SS-bond F3 mint viii-yidc-4 1 Coat protein 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P03623:p.Ile27Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Tue Jul 12 10:23:44 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 17:39:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile27cys' Tue Jun 30 19:22:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile27Cys' range MINT-6795952: original sequence: 27-27 : ADITTIGGAIIVLAAVVLGI YidC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TM1 P25714:p.Phe17Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain F C Tue Jul 12 10:58:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 19:37:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe17cys' Tue Jun 30 16:24:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe17Cys' range MINT-6795948: original sequence: 17-17 : LLVIALLFVSFMIWQAWEQD disulfide bond disulfide bond disulfide bridge SS-bond F5 mint