HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Journal of general virology 2008 imex curation Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk Accepted 2017-AUG-17 AT 14:41 BST AT 14:41 BST by MGT human liver cDNA library The Journal of general virology 2008 imex curation The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Journal of general virology 2008 imex curation Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk Accepted 2017-AUG-17 AT 14:41 BST AT 14:41 BST by MGT The Journal of general virology 2008 imex curation The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Journal of general virology 2008 imex curation Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk Accepted 2017-AUG-17 AT 14:41 BST AT 14:41 BST by MGT The Journal of general virology 2008 imex curation The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Journal of general virology 2008 imex curation Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk Accepted 2017-AUG-17 AT 14:41 BST AT 14:41 BST by MGT The Journal of general virology 2008 imex curation The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Npro product of classical swine fever virus interacts with IkappaBalpha, the NF-kappaB inhibitor. The Journal of general virology 2008 imex curation Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk 05-Sep-2017: Contacted by IntAct-Help. Only protein-protein interactions imex curation pig-max Max kidney cell line Pig pig-max Max kidney cell line Max kidney cell line from an inbred NIH minipig major histocompatibility complex d/d haplotype pull down pull down western blot western blot Immuno blot Immuno blot Doceul V., Charleston B., Crooke H., Reid E., Powell PP., Seago J. Virus - Publications including interactions involving viral proteins julian.seago@bbsrc.ac.uk Accepted 2017-AUG-17 AT 14:41 BST AT 14:41 BST by MGT The Journal of general virology 2008 imex curation p21530-pro_0000038062 N-terminal protease protein protein csfvb Classical swine fever virus (strain Brescia) Hog cholera virus MELNHFELLYKTNKQKPMGVEEPVYDVTGRPLFGDPSEVHPQSTLKLPHDRGRGNIKTTLKNLPRRGDCRSGNHLGPVSGIYVKPGPVFYQDYMGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCIDGCILLKLAKRGEPRTLKWIRNLTDCPLWVTSC 1 168 956408C097468D94 ikba_pig NF-kappa-B inhibitor alpha NFKBIA IKBA ECI-6 I-kappa-B-alpha protein protein pig Sus scrofa (Pig) Pig MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAPRGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVLGGQRLTL 629BEDB824562E95 ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 npro-ikbalpha-1 1 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association results pro_0000038062-nfkbia-1 4 8 unspecified role unspecified role prey prey clone15 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association 1 Full length hIkBa was unable to interact with CSFV Npro. . npro-nfkbia-2 2 8 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 pro_0000038062-nfkbia-2 3 7 unspecified role unspecified role prey prey purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 2 & 3 pro_0000038062-nfkbia-3 5 8 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 pro_0000038062-nfkbia-4 5 7 unspecified role unspecified role prey prey purified purified 6 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 pro_0000038062-nfkbia-5 5 7 unspecified role unspecified role prey prey purified purified v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 nfkbia-pro_0000038062-1 5 7 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey purified purified physical association physical association 3