UniProt UniProt http://www.uniprot.org The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus. The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus. Retrovirology 2007 imex curation Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. luc.desgroseillers@umontreal.ca Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. bret bioluminescence resonance energy transfer BRET LRET LRET BRET bret tag fluorescence tag visualisation by fluorescence tag fluorescence Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins luc.desgroseillers@umontreal.ca Accepted 2015-MAR-23 by MGT Retrovirology 2007 IMEx mimix curation The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus. The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus. Retrovirology 2007 imex curation Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. luc.desgroseillers@umontreal.ca Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins luc.desgroseillers@umontreal.ca Accepted 2015-MAR-23 by MGT Retrovirology 2007 IMEx mimix curation The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus. The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus. Retrovirology 2007 imex curation Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins HIV-1 gag has been mapped to the UniProt reference strain. Origin of Stau1 according Chatel-Chaix et al 2007, pmid 17428849. luc.desgroseillers@umontreal.ca Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chatel-Chaix L., Boulay K., Mouland AJ., Desgroseillers L. Virus - Publications including interactions involving viral proteins luc.desgroseillers@umontreal.ca Accepted 2015-MAR-18 by MGT Retrovirology 2007 IMEx mimix curation o95793-2 Double-stranded RNA-binding protein Staufen homolog 1 STAU1 STAU protein protein human Homo sapiens Human MKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC 509B6CF2B928C02C gag_hv1h2 Gag polyprotein gag Pr55Gag protein protein hv1h2 Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1) HIV-1 MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLRSLFGNDPSSQ B74C3858C20EF82C stau1-gag-1 1 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transfection nucleic acid transfection nucl transfection NC+P_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P04591:p.Cys392Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:51:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys392ser' Tue Jun 30 17:01:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys392Ser' P04591:p.Cys426Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:17:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys426ser' Tue Jun 30 19:54:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys426Ser' P04591:p.Arg384_Lys388delinsSerAsnGlnSerSer mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain RNQRK SNQSS Fri Jul 22 11:08:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'r7' Wed May 02 16:54:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_asn_gln_arg_lys384-388ser_asn_gln_ser_ser' Tue Jun 30 16:55:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg384_Lys388delinsSerAsnGlnSerSer' P04591:p.[Cys392Ser;Cys426Ser] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:33:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys392ser,cys426ser' Tue Jun 30 18:33:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys392Ser;Cys426Ser]' 4 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection c_terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction 2A and B gag-stau1-1 2 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P04591:p.[Cys392Ser;Cys426Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:51:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys426ser,cys392ser' Wed May 02 15:54:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys392ser,cys426ser' Tue Jun 30 15:45:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys392Ser;Cys426Ser]' 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2D gag-1 1 5 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection c-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transfection nucleic acid transfection nucl transfection c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P04591:p.[Cys392Ser;Cys426Ser] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:37:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys392ser,cys426ser' Tue Jun 30 17:47:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys392Ser;Cys426Ser]' proximity proximity close-contact colocalization neighbourhood interaction 3, 4 Stau1 UniProt AC O95793-2 enhances gag multimerization; Stau1 N-terminus 1-88 is required for the effect; Stau1 full length phe135ala construct has no effect gag-stau1-2 1 5 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection c-terminus renilla luciferase renilla luciferase protein tag renilla luciferase c-term range C-terminal range c-term range c-term range C-terminal range c-term range cap2ncp1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept nucl transfection nucleic acid transfection nucl transfection c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range dnt88 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O95793-2:p.Phe135Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:55:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe135ala' Tue Jun 30 19:36:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe135Ala' dsrna-bd_dom required to bind necessary binding region required to bind range range range range proximity proximity close-contact colocalization neighbourhood interaction 5 gag-stau1-3 3 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 5E