MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. FEBS Lett. (0014-5793) 2007 imex curation Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. FEBS Lett. (0014-5793) 2007 imex curation Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. FEBS Lett. (0014-5793) 2007 imex curation Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor. FEBS Lett. (0014-5793) 2007 imex curation Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Giguère P., Turcotte ME., Hamelin E., Parent A., Brisson J., Laroche G., Labrecque P., Dupuis G., Parent JL. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation prdx4_human Peroxiredoxin-4 PRDX4 Peroxiredoxin IV Thioredoxin peroxidase AO372 Thioredoxin-dependent peroxide reductase A0372 Antioxidant enzyme AOE372 Thioredoxin-dependent peroxiredoxin 4 protein protein human Homo sapiens Human MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN 7E56B580049FC60F calx_human Calnexin CANX Major histocompatibility complex class I antigen-binding protein p88 p90 IP90 protein protein human Homo sapiens Human MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE DIP protein P27824 original sequence version: 177 EDE094D9B82261EE ta2r_human Thromboxane A2 receptor TBXA2R Prostanoid TP receptor protein protein human Homo sapiens Human MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTRSSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPLLLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPGSWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSEVEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWNQILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ DIP protein P21731 original sequence version: 125 114A7C3F3F0D35F1 tbxa2r-prdx4 1 TP beta 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association NFA FEBS-Letters pag. 3864 first paragraph homomint mint tbxa2r-prdx4-1 4 TP beta 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prx4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1 FEBS-Letters homomint mint tbxa2r-prdx4-2 3 TP beta 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prx4 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F2B FEBS-Letters TF beta can interact through the following fragments with Prx4: 129-150, 217-244, 312-407 homomint mint canx-prdx4 2 calnexin A 6 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell TP beta 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined prx4 5 anti tag immunost anti tag immunostaining anti tag immunost predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F5 FEBS-Letters homomint mint