MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. J. Gen. Virol. (0022-1317) 2007 rapid curation Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins suggested by panni J. Gen. Virol. (0022-1317) 2007 rapid curation rapid curation Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. J. Gen. Virol. (0022-1317) 2007 rapid curation Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins suggested by panni J. Gen. Virol. (0022-1317) 2007 rapid curation rapid curation Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. Functional and structural studies of the vaccinia virus virulence factor N1 reveal a Bcl-2-like anti-apoptotic protein. J. Gen. Virol. (0022-1317) 2007 rapid curation Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Cooray S., Bahar MW., Abrescia NG., McVey CE., Bartlett NW., Chen RA., Stuart DI., Grimes JM., Smith GL. Virus - Publications including interactions involving viral proteins suggested by panni J. Gen. Virol. (0022-1317) 2007 rapid curation rapid curation bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 n1_vaccw Protein N1 VACWR028 N1L protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MRTLLIRYILWRNDNDQTYYNDNFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVARDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK mint 9E5E2110CE51B3A1 bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 bid-n1-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association F4a homomint mint bax-n1-1 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F4a homomint mint bad-n1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F4a homomint mint bax-n1-2 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association F4b homomint mint bad-n1-1 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F4b homomint mint n1-n1-1 3 5 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association F5 homomint mint