UniProt UniProt http://www.uniprot.org HIV1 Vpr arrests the cell cycle by recruiting DCAF1/VprBP, a receptor of the Cul4-DDB1 ubiquitin ligase. HIV1 Vpr arrests the cell cycle by recruiting DCAF1/VprBP, a receptor of the Cul4-DDB1 ubiquitin ligase. Cell Cycle (1538-4101) 2007 imex curation Le Rouzic E., Bela�douni N., Estrabaud E., Morel M., Rain J.C., Transy C., Margottin-Goguet F. Virus - Publications including interactions involving viral proteins Origin of HIV-1 Vpr and UNG according Ref. 29 PMID 9151883). Origin of DDB1 according PMID 7815490 following Ref. 30 (PMID 10980617). Origin of VPX SIVmac according sequence in fig 4c. margottin-goguet@cochin.inserm.fr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Le Rouzic E., Bela�douni N., Estrabaud E., Morel M., Rain J.C., Transy C., Margottin-Goguet F. Virus - Publications including interactions involving viral proteins Origin of HIV-1 Vpr and UNG according Ref. 29 PMID 9151883). Origin of DDB1 according PMID 7815490 following Ref. 30 (PMID 10980617). Origin of VPX SIVmac according sequence in fig 4c. margottin-goguet@cochin.inserm.fr Accepted 2014-NOV-11 by ORCHARD Cell Cycle (1538-4101) 2007 imex curation HIV1 Vpr arrests the cell cycle by recruiting DCAF1/VprBP, a receptor of the Cul4-DDB1 ubiquitin ligase. HIV1 Vpr arrests the cell cycle by recruiting DCAF1/VprBP, a receptor of the Cul4-DDB1 ubiquitin ligase. Cell Cycle (1538-4101) 2007 imex curation Le Rouzic E., Bela�douni N., Estrabaud E., Morel M., Rain J.C., Transy C., Margottin-Goguet F. Virus - Publications including interactions involving viral proteins Origin of HIV-1 Vpr and UNG according Ref. 29 PMID 9151883). Origin of DDB1 according PMID 7815490 following Ref. 30 (PMID 10980617). Origin of VPX SIVmac according sequence in fig 4c. margottin-goguet@cochin.inserm.fr 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Le Rouzic E., Bela�douni N., Estrabaud E., Morel M., Rain J.C., Transy C., Margottin-Goguet F. Virus - Publications including interactions involving viral proteins Origin of HIV-1 Vpr and UNG according Ref. 29 PMID 9151883). Origin of DDB1 according PMID 7815490 following Ref. 30 (PMID 10980617). Origin of VPX SIVmac according sequence in fig 4c. margottin-goguet@cochin.inserm.fr Accepted 2014-NOV-11 by ORCHARD Cell Cycle (1538-4101) 2007 imex curation q9y4b6-3 DDB1- and CUL4-associated factor 1 DCAF1 HIV-1 Vpr-binding protein KIAA0800 RIP Serine/threonine-protein kinase VPRBP VPRBP Vpr-interacting protein protein protein human Homo sapiens Human MTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLIEKETEEYRKGDPDPFDDRHPGRADPECMLGHLLRILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAVVFQEKEGIVENLFKWAREADQPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLRELQLQEVALRQENKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDDAEIQKSALQIIINCVCGPDNRISSIGKFISGTPRRKLPQNPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKALVGLSRSSTVRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGTDVSLARLQKADVVAQSRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAASHSSAFTPVTAAASPVSLPRTPRIANGIATRLGSHAAVGASAPSAPTAHPQPRPPQGPLALPGPSYAGNSPLIGRISFIRERPSPCNGRKIRVLRQKSDHGAYSQSPAIKKQLDRHLPSPPTLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRRQAPINFTSRLNRRASFPKYGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSGQEEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDDLMEERMKSPFGSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNMDTVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEEDDNNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDDIILSLNE No experimental confirmation available. A5A53818C128F546 vpr_hv1br Protein Vpr vpr R ORF protein Viral protein R protein protein hv1br Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) HIV-1 MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS 42892A4186E83D3E ddb1_human DNA damage-binding protein 1 DDB1 Damage-specific DNA-binding protein 1 UV-damaged DNA-binding factor DDB p127 subunit DNA damage-binding protein a UV-damaged DNA-binding protein 1 Xeroderma pigmentosum group E-complementing protein XPE-binding factor HBV X-associated protein 1 XAP1 protein protein human Homo sapiens Human MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH DIP protein Q16531 original sequence version: 145 DIP protein Q16531 original sequence version: 140 DIP protein Q16531 original sequence version: 99 DIP protein Q16531 original sequence version: 93 DIP protein Q16531 original sequence version: 116 DIP protein Q16531 original sequence version: 111 DIP protein Q16531-1 original sequence version: 163 DIP protein Q16531 original sequence version: 162 DIP protein Q16531 original sequence version: 113 DIP protein Q16531 original sequence version: 132 DIP protein Q16531 original sequence version: 139 DIP protein Q16531 original sequence version: 151 DIP protein Q16531-1 original sequence version: 144 DIP protein Q16531 original sequence version: 155 74D082023E3D846D vpx_sivsp Protein Vpx vpx Viral protein X X ORF protein protein protein sivsp Simian immunodeficiency virus (isolate PBj14/BCL-3) MSDPRERIPPGNSGEETIGEAFDWLDRTVEEINRAAVNHLPRELIFQVWRRSWEYWHDEMGMSVSYTKYRYLCLIQKAMFMHCKKGCRCLGGEHGAGGWRPGPPPPPPPGLA DIP protein P19508 original sequence version: 51 226D0BF3A0FD2713 ung_human Uracil-DNA glycosylase UNG DGU UNG15 UNG1 protein protein human Homo sapiens Human MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL A4B27E6198AFE9C0 vpr-vprbp 1 4 unspecified role unspecified role bait bait P05928:p.Gln65Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 17:57:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln65arg' Tue Jun 30 20:08:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln65Arg' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P05928:p.Gln65Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 18:03:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln65ala' Tue Jun 30 20:18:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln65Ala' 3 unspecified role unspecified role prey prey wd40_repeat_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 11 physical association physical association 4A, S1A and B vprbp-ddb1-2 2 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2A Detected in presence of HA-tagged HIV-1 Vpr (UniProt AC P05928) wildtype and gln65arg mutant ddb1-vpr-2 2 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined wd40_repeat_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association 2B vpr-ung 1 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association S1A vpx-vprbp 1 6 unspecified role unspecified role bait bait P19508:p.Gln76Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 18:26:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln76arg' Tue Jun 30 16:15:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln76Arg' 3 unspecified role unspecified role prey prey physical association physical association 4A and B vprbp-vpr 2 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P05928:p.Gln65Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Q R Wed May 02 15:07:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln65arg' Tue Jun 30 19:43:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln65Arg' 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1A