HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Classical swine fever virus Npro interacts with interferon regulatory factor 3 and induces its proteasomal degradation. Classical swine fever virus Npro interacts with interferon regulatory factor 3 and induces its proteasomal degradation. Journal of virology 2007 imex curation Bauhofer O., Summerfield A., Sakoda Y., Tratschin JD., Hofmann MA., Ruggli N. Virus - Publications including interactions involving viral proteins nicolas.ruggli@ivi.admin.ch 15-Sep-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bauhofer O., Summerfield A., Sakoda Y., Tratschin JD., Hofmann MA., Ruggli N. Virus - Publications including interactions involving viral proteins nicolas.ruggli@ivi.admin.ch Accepted 2016-SEP-06 AT 08:22 BST AT 08:22 BST by ORCHARD Journal of virology 2007 imex curation p19712-pro_0000038050 N-terminal protease protein protein CSFV Classical swine fever virus (strain Alfort) Hog cholera virus MELNHFELLYKTSKQKPVGVEEPVYDTAGRPLFGNPSEVHPQSTLKLPHDRGRGDIRTTLRDLPRKGDCRSGNHLGPVSGIYIKPGPVYYQDYTGPVYHRAPLEFFDEAQFCEVTKRIGRVTGSDGKLYHIYVCVDGCILLKLAKRGTPRTLKWIRNFTNCPLWVTSC 1 168 F2D196BB6A5F0F47 irf3_pig Interferon regulatory factor 3 IRF3 protein protein pig Sus scrofa (Pig) Pig MGTQKPRILPWLISQLNQGQLEGVAWLDEGHTRFRIPWKHGLRQDAQQEDFGIFQAWAEASGAYTPGKDKPDLPTWKRNFRSALNRKEALRLAEDHSKDPHDPHKIYEFVTSGVGDFPEPDTSLDLSGRYSTSDTHEDSLDKLLSGMDLASDAGPQSLTLALEQPPQLSLSPSVDAPASCPNLGVRENPLKQLLANDDEWEFQVTVFYRGCQVFQQTVCSPGGLRLVGSEAEDGTLAGQPVRLPDPAASLTDRGVADYVRRVLSCLGGGLALWRAGQWLWAQRLGHCHVYWAMGEELIPDSGHKPDGEVPKDREGGVFDLGPFIEDLIAFIEGSRRSPRYTLWFCMGQSWPQDEPWVKRLVMVKVVPMCLRALVDMARDGGASSLENTVDLHISNSHPLSLTSDQYKACLRDLVEDMDF 8B731861BE002284 npro-irf3-2 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 5A irf3-npro-1 1 2 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association 5B