MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. FEBS Lett. (0014-5793) 2007 imex curation Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. FEBS Lett. (0014-5793) 2007 imex curation Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. Interaction of rice dwarf virus outer capsid P8 protein with rice glycolate oxidase mediates relocalization of P8. FEBS Lett. (0014-5793) 2007 imex curation Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhou F., Wu G., Deng W., Pu Y., Wei C., Li Y. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation p8_rdva Outer capsid protein P8 Structural protein P8 protein protein rdva Rice dwarf virus (isolate Akita) MSRQMWLDTSALLEAISEYVVRCNGDTFSGLTTGDFNALSNMFTQLSVSSAGYVSDPRVPLQTMSNMFVSFITSTDRCGYMLRKTWFNSDTKPTVSDDFITTYIRPRLQVPMSDTVRQLNNLSLQPSAKPKLYERQNAIMKGLDIPYSEPIEPCKLFRSVAGQTGNIPMMGILATPPAAQQQPFFVAERRRILFGIRSNAAIPAGAYQFVVPAWASVLSVTGAYVYFTNSFFGTTIAGVTATATAADAATTFTVPTDANNLPVQTDSRLSFSLGGGNINLELGVAKTGFCVAIEGEFTILANRSQAYYTLNSITQTPTSIDDFDVSDFLTTFLSQLRACGQYEIFSDAMDQLTNSLITNYMDPPALPAGLAFTSPWFRFSERARTILALQNVDLNIRKLIVRHLWVITSLIAVFGRYYRPN mint 3CB62513EBA5D8D6 o22544_orysa (S)-2-hydroxy-acid oxidase GOX protein protein orysa Oryza sativa (Rice) Rice MGEITNVMEYQAIANQNLPKMIYDYYSSGAEDDWTLKENREAFSAILFRPRILIDVSKIDMSATVLGFKISMPIMIAPSAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGNPFLHLYLCKDRNVVEHLVKKTKRAGFKAIALTVDAPRLGRRETDIKNRFVLPPYLTLKKFEGLDLPEMDKSNDSGLASYVAGQIDRALTWKDVKWLQSITSLPILVKGVITAEDAKLAVHSGAAGIIVSNHGARQLDYVPATISALEEVVTAAAGRIPVYLDGGVRRGTDVFKALALGAAGVFIGKPVVFALAAEGKAGVRNLLRMMREEFELTMAFSGCTSLADITRAHIYTDAERLARPFPRL mint 5C4FADB9ABABC8D6 p8-gox 3 p8 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gox 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1 FEBS-Letters mint p8-gox-1 1 p8 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gox 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3 F5 FEBS-Letters mint gox-p8 1 Gox 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined p8 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3 F5 FEBS-Letters mint gox-p8-1 2 p8 4 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gox 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4B FEBS-Letters mint