MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. FEBS Lett. (0014-5793) 2007 imex curation Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. FEBS Lett. (0014-5793) 2007 imex curation Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro phosphatase assay phosphatase assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. FEBS Lett. (0014-5793) 2007 imex curation Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. FEBS Lett. (0014-5793) 2007 imex curation Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. Determination of the Plk4/Sak consensus phosphorylation motif using peptide spots arrays. FEBS Lett. (0014-5793) 2007 imex curation Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Leung GC., Ho CS., Blasutig IM., Murphy JM., Sicheri F. Virus - Publications including interactions involving viral proteins FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation p02686-1 Myelin basic protein MBP Myelin A1 protein Myelin membrane encephalitogenic protein Golli-MBP1 HOG7 protein protein human Homo sapiens Human MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR mint 4AD7305C1D5434C4 ccnb3_human G2/mitotic-specific cyclin-B3 CCNB3 CYCB3 protein protein human Homo sapiens Human MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESPSSLQGALKKRSAFEDLTNASQCQPVQPKKEANKEFVKVVSKKINRNTHALGLAKKNKRNLKWHKLEVTPVVASTTVVPNIMEKPLILDISTTSKTPNTEEASLFRKPLVLKEEPTIEDETLINKSLSLKKCSNHEEVSLLEKLQPLQEESDSDDAFVIEPMTFKKTHKTEEAAITKKTLSLKKKMCASQRKQSCQEESLAVQDVNMEEDSFFMESMSFKKKPKTEESIPTHKLSSLKKKCTIYGKICHFRKPPVLQTTICGAMSSIKKPTTEKETLFQELSVLQEKHTTEHEMSILKKSLALQKTNFKEDSLVKESLAFKKKPSTEEAIMMPVILKEQCMTEGKRSRLKPLVLQEITSGEKSLIMKPLSIKEKPSTEKESFSQEPSALQKKHTTQEEVSILKEPSSLLKSPTEESPFDEALAFTKKCTIEEAPPTKKPLILKRKHATQGTMSHLKKPLILQTTSGEKSLIKEPLPFKEEKVSLKKKCTTQEMMSICPELLDFQDMIGEDKNSFFMEPMSFRKNPTTEETVLTKTSLSLQEKKITQGKMSHLKKPLVLQKITSEEESFYKKLLPFKMKSTTEEKFLSQEPSALKEKHTTLQEVSLSKESLAIQEKATTEEEFSQELFSLHVKHTNKSGSLFQEALVLQEKTDAEEDSLKNLLALQEKSTMEEESLINKLLALKEELSAEAATNIQTQLSLKKKSTSHGKVFFLKKQLALNETINEEEFLNKQPLALEGYPSIAEGETLFKKLLAMQEEPSIEKEAVLKEPTIDTEAHFKEPLALQEEPSTEKEAVLKEPSVDTEAHFKETLALQEKPSIEQEALFKRHSALWEKPSTEKETIFKESLDLQEKPSIKKETLLKKPLALKMSTINEAVLFEDMIALNEKPTTGKELSFKEPLALQESPTYKEDTFLKTLLVPQVGTSPNVSSTAPESITSKSSIATMTSVGKSGTINEAFLFEDMITLNEKPTTGKELSFKEPLALQESPTCKEDTFLETFLIPQIGTSPYVFSTTPESITEKSSIATMTSVGKSRTTTESSACESASDKPVSPQAKGTPKEITPREDIDEDSSDPSFNPMYAKEIFSYMKEREEQFILTDYMNRQIEITSDMRAILVDWLVEVQVSFEMTHETLYLAVKLVDLYLMKAVCKKDKLQLLGATAFMIAAKFEEHNSPRVDDFVYICDDNYQRSEVLSMEINILNVLKCDINIPIAYHFLRRYARCIHTNMKTLTLSRYICEMTLQEYHYVQEKASKLAAASLLLALYMKKLGYWVPFLEHYSGYSISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLEEILNCDCEAQGLVL 454552BC5A67E34E pp_lambd Serine/threonine-protein phosphatase protein protein lambd Enterobacteria phage lambda Bacteriophage lambda MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVECLELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKADELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGADTFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA DIP protein P03772 original sequence version: 71 5CE0E1A0F3BC5CB5 plk4_mouse Serine/threonine-protein kinase PLK4 Plk4 Sak Stk18 Polo-like kinase 4 Serine/threonine-protein kinase Sak Serine/threonine-protein kinase 18 protein protein mouse Mus musculus Mouse MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSRAKTYSVERCHSVEMLSKPRRSLDENQHSSNHHCLGKTPFPFADQTPQMEMVQQWFGNLQMNAHLGETNEHHTVSPNRDFQDYPDLQDTLRNAWTDTRASKNADTSANVHAVKQLSAMKYMSAHHHKPEVMPQEPGLHPHSEQSKNRSMESTLGYQKPTLRSITSPLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECASEGYVKEVLQISSDGTMITVYYPNDGRGFPLADRPPLPTDNISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGAKIHKTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLSLESVISEEEKRSRGSSFFPIIVGRKPGNTSSPKALSAPPVDPSCCKGEQASASRLSVNSAAFPTQSPGLSPSTVTVEGLGHTATATGTGVSSSLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPDGQTTRYGENEKLPEYIKQKLQCLSSILLMFSNPTPNFQ F28A64ED24D9C801 plk4-pp 2 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 15:01:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was mutation disrupting Lys154Asn range MINT-4053833: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053830: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR lambda phospatase 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified dephosphorylation dephosphorylation reaction dephosphorylation F1A FEBS-Letters mint plk4-pp-1 2 lambda phospatase 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053845: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR dephosphorylation dephosphorylation reaction dephosphorylation F1A FEBS-Letters mint mbp-plk4 4 MBP 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:19:57 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:19:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 17:25:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4053871: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053864: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR phosphorylation phosphorylation reaction phosphorylation F1B FEBS-Letters homomint mint mbp-plk4-1 4 MBP 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053889: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR phosphorylation phosphorylation reaction phosphorylation F1B FEBS-Letters homomint mint plk4-plk4-1 4 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme self self purified purified Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:19:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:45:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 18:56:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4053913: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053903: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate self self purified purified Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:11:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:17:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 18:08:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4053922: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053919: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation F1B FEBS-Letters homomint mint plk4-plk4-2 4 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate self self purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053931: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme self self purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053944: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR phosphorylation phosphorylation reaction phosphorylation F1B FEBS-Letters homomint mint plk4-plk4-3 5 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain KIM range MINT-4053955: original sequence: 525-796 : LHPHSEQSKNRSMESTLGYQKPTLRSITSPLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECASEGYVKEVLQISSDGTMITVYYPNDGRGFPLADRPPLPTDNISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGAKIHKTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLSLESVISEEEKRSRGSSFFPIIVGRKPGNTSSPKALSAPPVDPSCCKGEQASAS flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053961: original sequence: 1-595 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSRAKTYSVERCHSVEMLSKPRRSLDENQHSSNHHCLGKTPFPFADQTPQMEMVQQWFGNLQMNAHLGETNEHHTVSPNRDFQDYPDLQDTLRNAWTDTRASKNADTSANVHAVKQLSAMKYMSAHHHKPEVMPQEPGLHPHSEQSKNRSMESTLGYQKPTLRSITSPLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECASEGYV myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association SF1A FEBS-Letters homomint mint plk4-plk4-4 3 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4053986: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain KIM range MINT-4053993: original sequence: 525-796 : LHPHSEQSKNRSMESTLGYQKPTLRSITSPLIAHRLKPIRQKTKKAVVSILDSEEVCVELLRECASEGYVKEVLQISSDGTMITVYYPNDGRGFPLADRPPLPTDNISRYSFDNLPEKYWRKYQYASRFIQLVRSKTPKITYFTRYAKCILMENSPGADFEVWFYDGAKIHKTENLIHIIEKTGISYNLKNENEVTSLKEEVKVYMDHANEGHRICLSLESVISEEEKRSRGSSFFPIIVGRKPGNTSSPKALSAPPVDPSCCKGEQASAS his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction SF1B FEBS-Letters homomint mint ccnb3-plk4 1 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:15:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:41:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 15:58:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4054076: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4054062: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR CYCB3 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain KIM range MINT-4054071: original sequence: 287-289 : SIPTHKLSSLKKKCTIYGKICH undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:08:33 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 291 range MINT-4054085: original sequence: 291-291 : HKLSSLKKKCTIYGKICHFR phosphorylation phosphorylation reaction phosphorylation F2D STS1 STS2 FEBS-Letters homomint mint ccnb3-plk4-1 1 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4054116: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:49:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:16:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 19:30:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4054113: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM CYCB3 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:03:28 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 292 range MINT-4054100: original sequence: 292-292 : KLSSLKKKCTIYGKICHFRK binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain KIM range MINT-4054107: original sequence: 287-289 : SIPTHKLSSLKKKCTIYGKICH phosphorylation phosphorylation reaction phosphorylation F2D STS1 STS2 FEBS-Letters homomint mint ccnb3-plk4-2 1 Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4054130: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:49:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:03:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 17:15:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4054133: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM CYCB3 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:03:08 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 293 range MINT-4054143: original sequence: 293-293 : LSSLKKKCTIYGKICHFRKP binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain KIM range MINT-4054140: original sequence: 287-289 : SIPTHKLSSLKKKCTIYGKICH phosphorylation phosphorylation reaction phosphorylation F2D STS1 STS2 FEBS-Letters homomint mint ccnb3-plk4-3 1 CYCB3 7 peptide synthesis peptide synthesis predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain KIM range MINT-4054165: original sequence: 287-289 : SIPTHKLSSLKKKCTIYGKICH undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:02:18 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 295 range MINT-4054161: original sequence: 295-295 : SLKKKCTIYGKICHFRKPPV Sak 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q64702:p.Asp154Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D N Tue Jul 12 10:06:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:18:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp154asn' Tue Jun 30 16:33:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp154Asn' range MINT-4054171: original sequence: 154-154 : LTRNMNIKIADFGLATQLNM binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-4054174: original sequence: 1-390 : MAACIGERIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHPSVLELYNYFEDNNYVYLVLEMCHNGEMNRYLKNRMKPFSEREARHFMHQIITGMLYLHSHGILHRDLTLSNILLTRNMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEIATRSAHGLESDIWSLGCMFYTLLIGRPPFDTDTVKNTLNKVVLADYEMPAFLSREAQDLIHQLLRRNPADRLSLSSVLDHPFMSRNPSPKSKDVGTVEDSMDSGHATLSTTITASSGTSLSGSLLDRRLLVGQPLPNKITVFQKNKNSSDFSSGDGSNFCTQWGNPEQEANSRGRGRVIEDAEERPHSRYLRRAHSSDRASPSNQSR phosphorylation phosphorylation reaction phosphorylation F2D STS1 STS2 FEBS-Letters homomint mint