UniProt UniProt http://www.uniprot.org Identification of the LEDGF/p75 binding site in HIV-1 integrase. Identification of the LEDGF/p75 binding site in HIV-1 integrase. J. Mol. Biol. (0022-2836) 2007 imex curation Busschots K., Voet A., De Maeyer M., Rain J.C., Emiliani S., Benarous R., Desender L., Debyser Z., Christ F. Virus - Publications including interactions involving viral proteins HIV-1 vector pNL4-3 is an artificial sequence. According to ref 14 (pubmed 12796494) HIV-1 clone pNL4-3 has been used with NCBI AC M19921 which was mapped to UniProt zeger.debyser@med.kuleuven.be 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Busschots K., Voet A., De Maeyer M., Rain J.C., Emiliani S., Benarous R., Desender L., Debyser Z., Christ F. Virus - Publications including interactions involving viral proteins HIV-1 vector pNL4-3 is an artificial sequence. According to ref 14 (pubmed 12796494) HIV-1 clone pNL4-3 has been used with NCBI AC M19921 which was mapped to UniProt zeger.debyser@med.kuleuven.be Accepted 2015-FEB-13 by MGT J. Mol. Biol. (0022-2836) 2007 Only protein-protein interactions imex curation Identification of the LEDGF/p75 binding site in HIV-1 integrase. Identification of the LEDGF/p75 binding site in HIV-1 integrase. J. Mol. Biol. (0022-2836) 2007 imex curation Busschots K., Voet A., De Maeyer M., Rain J.C., Emiliani S., Benarous R., Desender L., Debyser Z., Christ F. Virus - Publications including interactions involving viral proteins HIV-1 vector pNL4-3 is an artificial sequence. According to ref 14 (pubmed 12796494) HIV-1 clone pNL4-3 has been used with NCBI AC M19921 which was mapped to UniProt zeger.debyser@med.kuleuven.be 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Busschots K., Voet A., De Maeyer M., Rain J.C., Emiliani S., Benarous R., Desender L., Debyser Z., Christ F. Virus - Publications including interactions involving viral proteins HIV-1 vector pNL4-3 is an artificial sequence. According to ref 14 (pubmed 12796494) HIV-1 clone pNL4-3 has been used with NCBI AC M19921 which was mapped to UniProt zeger.debyser@med.kuleuven.be Accepted 2015-FEB-13 by MGT J. Mol. Biol. (0022-2836) 2007 Only protein-protein interactions imex curation o75475-1 PC4 and SFRS1-interacting protein p75 PSIP1 PSIP1 DFS70 LEDGF PSIP2 CLL-associated antigen KW-7 Dense fine speckles 70 kDa protein Lens epithelium-derived growth factor Transcriptional coactivator p75/p52 protein protein human Homo sapiens Human MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN Less active than isoform 2 as transcriptional coactivator, but more abundant in cells. 4B653D02B1D0E174 p12497-pro_0000042402 Integrase gag-pol Pr160Gag-Pol protein protein hv1n5 Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1) HIV-1 FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED 1148 1435 0680E5CD1E201580 gag_pol-psip1-24 1 3 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified P12497-PRO_0000042402:p.Trp132Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:10:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp132ala' Tue Jun 30 20:03:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp132Ala' c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P12497-PRO_0000042402:p.Ile161Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain I A Wed May 02 18:37:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile161ala' Tue Jun 30 18:30:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile161Ala' P12497-PRO_0000042402:p.Arg166Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:13:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg166ala' Tue Jun 30 17:12:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg166Ala' P12497-PRO_0000042402:p.Asp167Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 14:33:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp167ala' Tue Jun 30 20:07:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp167Ala' P12497-PRO_0000042402:p.Gln168Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 17:33:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln168ala' Tue Jun 30 16:03:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln168Ala' P12497-PRO_0000042402:p.Glu170Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:05:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu170ala' Tue Jun 30 18:53:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu170Ala' P12497-PRO_0000042402:p.Trp131Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain W A Wed May 02 15:05:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp131ala' Tue Jun 30 16:11:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp131Ala' P12497-PRO_0000042402:p.Gln164Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 15:30:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln164ala' Tue Jun 30 20:25:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln164Ala' P12497-PRO_0000042402:p.Val165Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:59:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val165ala' Tue Jun 30 19:33:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val165Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2a and Table 1 gag_pol-psip1-25 1 3 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified P12497-PRO_0000042402:p.Asp64Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:45:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp64ala' Tue Jun 30 19:59:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp64Ala' P12497-PRO_0000042402:p.Gln168Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true Q A Wed May 02 16:36:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln168ala' Tue Jun 30 19:15:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln168Ala' P12497-PRO_0000042402:p.Arg166Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true R A Wed May 02 15:23:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg166ala' Tue Jun 30 20:13:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg166Ala' P12497-PRO_0000042402:p.Trp132Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true W A Wed May 02 20:21:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp132ala' Tue Jun 30 17:46:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp132Ala' P12497-PRO_0000042402:p.Trp131Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true W A Wed May 02 16:24:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp131ala' Tue Jun 30 17:46:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp131Ala' n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P12497-PRO_0000042402:p.Glu170Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true E A Wed May 02 17:59:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu170ala' Tue Jun 30 17:10:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu170Ala' P12497-PRO_0000042402:p.Val165Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true V A Wed May 02 15:30:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val165ala' Tue Jun 30 18:42:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val165Ala' P12497-PRO_0000042402:p.Ile161Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true I A Wed May 02 14:49:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile161ala' Tue Jun 30 18:12:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile161Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2b and Table 1 gag_pol-psip1-26 2 3 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait purified purified n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range true P12497-PRO_0000042402:p.Val165Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true V A Wed May 02 17:33:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val165ala' Tue Jun 30 17:25:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val165Ala' P12497-PRO_0000042402:p.Gln168Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain true Q A Wed May 02 16:26:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln168ala' Tue Jun 30 16:06:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln168Ala' P12497-PRO_0000042402:p.Arg166Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true R A Wed May 02 15:19:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg166ala' Tue Jun 30 18:32:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg166Ala' P12497-PRO_0000042402:p.Trp131Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true W A Wed May 02 19:37:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp131ala' Tue Jun 30 17:34:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp131Ala' P12497-PRO_0000042402:p.Trp132Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain true W A Wed May 02 18:54:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp132ala' Tue Jun 30 16:07:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp132Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2b