MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins suggested by aceol Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation rapid curation HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation unknown Unknown coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins suggested by aceol Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation rapid curation HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. HPV-18 E7 conjugates to c-Myc and mediates its transcriptional activity. Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation unknown Unknown 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang YW., Chang HS., Lin CH., Yu WC. Virus - Publications including interactions involving viral proteins suggested by aceol Int. J. Biochem. Cell Biol. (1357-2725) 2007 rapid curation rapid curation ve7_hpv11 Protein E7 E7 protein protein hpv11 Human papillomavirus type 11 MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCGCDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP E7 protein has both transforming and trans-activating activities. Disrupts the function of host retinoblastoma protein RB1/pRb, which is a key regulator of the cell cycle. Induces the disassembly of the E2F1 transcription factors from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Inactivation of the ability of RB1 to arrest the cell cycle is critical for cellular transformation, uncontrolled cellular growth and proliferation induced by viral infection. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. Interferes with histone deacetylation mediated by HDAC1 and HDAC2, leading to activation of transcription mint AACA9A60C933E1F6 ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP DIP protein P03129 original sequence version: 96 9BD612534CD2C9EB ve7_hpv18 Protein E7 E7 protein protein hpv18 Human papillomavirus type 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ DIP protein P06788 original sequence version: 78 2CDB119534D0186A myc_human Myc proto-oncogene protein BHLHE39 Transcription factor p64 MYC Proto-oncogene c-Myc Class E basic helix-loop-helix protein 39 protein protein human Homo sapiens Human MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA DIP protein P01106 original sequence version: 195 DIP protein P01106 original sequence version: 196 DIP protein P01106 original sequence version: 148 DIP protein P01106-1 original sequence version: 161 DIP protein P01106 original sequence version: 182 DIP protein P01106 original sequence version: 197 DIP protein P01106-1 original sequence version: 208 DIP protein P01106 original sequence version: 121 DIP protein P01106-1 original sequence version: 144 DIP protein P01106 original sequence version: 144 ED5C028029A4C5D1 e7-myc 3 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Tab 1 homomint mint e7-myc-1 3 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Tab 1 homomint mint e7-myc-2 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Tab 1 F3 homomint mint myc-e7 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F1 homomint mint myc-e7-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F1 homomint mint myc-e7-2 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association F1 F2 homomint mint e7-myc-3 2 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association F1 homomint mint myc-e7-3 2 MYC 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait E7 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey association association homomint mint F1 f3 myc-e7-4 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association F2 homomint mint