MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Control of protein phosphatase 2A by simian virus 40 small-t antigen. Control of protein phosphatase 2A by simian virus 40 small-t antigen. Mol. Cell. Biol. (0270-7306) 1991 rapid curation Yang SI., Lickteig RL., Estes R., Rundell K., Walter G., Mumby MC. Virus - Publications including interactions involving viral proteins manually identified rapid curation in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel predetermined predetermined participant predetermined Yang SI., Lickteig RL., Estes R., Rundell K., Walter G., Mumby MC. Virus - Publications including interactions involving viral proteins manually identified manually identified Mol. Cell. Biol. (0270-7306) 1991 rapid curation rapid curation st_sv40 Small t antigen protein protein sv40 sv40 SV40 MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWDATEVFASSLNPGVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYRDLKL 91EC925ED2E29668 91EC925ED2E29668 2aab_human Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform PPP2R1B PP2A subunit A isoform PR65-beta PP2A subunit A isoform R1-beta protein protein human Homo sapiens Human MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA DIP protein P30154 original sequence version: 145 86AB20D7505210B0 ppp2r1b-st 1 3 unspecified role unspecified role neutral component neutral component purified purified 2 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F3 homomint mint