MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Vaccinia virus G9 protein is an essential component of the poxvirus entry-fusion complex. Vaccinia virus G9 protein is an essential component of the poxvirus entry-fusion complex. J. Virol. (0022-538X) 2006 rapid curation Ojeda S., Domi A., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown pull down pull down predetermined predetermined participant predetermined Ojeda S., Domi A., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2006 rapid curation rapid curation Vaccinia virus G9 protein is an essential component of the poxvirus entry-fusion complex. Vaccinia virus G9 protein is an essential component of the poxvirus entry-fusion complex. J. Virol. (0022-538X) 2006 rapid curation Ojeda S., Domi A., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni rapid curation unknown Unknown cosedimentation cosedimentation predetermined predetermined participant predetermined Ojeda S., Domi A., Moss B. Virus - Publications including interactions involving viral proteins suggested by panni J. Virol. (0022-538X) 2006 rapid curation rapid curation g9_vaccw Myristoylated protein G9 G9R VACWR087 Protein F1 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MGGGVSVELPKRDPPPGVPTDEMLLNVDKMHDVIAPAKLLEYVHIGPLAKDKEDKVKKRYPEFRLVNTGPGGLSALLRQSYNGTAPNCCRTFNRTHYWKKDGKISDKYEEGAVLESCWPDVHDTGKCDVDLFDWCQGDTFDRNICHQWIGSAFNRSNRTVEGQQSLINLYNKMQTLCSKDASVPICESFLHHLRAHNTEDSKEMIDYILRQQSADFKQKYMRCSYPTRDKLEESLKYAEPRECWDPECSNANVNFLLTRNYNNLGLCNIVRCNTSVNNLQMDKTSSLRLSCGLSNSDRFSTVPVNRAKVVQHNIKHSFDLKLHLISLLSLLVIWILIVAI Involved in virus entry into host cell and for cell-cell fusion (syncytium formation) mint 025399172AB9ABC4 a28_vaccw Envelope protein A28 A28L VACWR151 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL Late protein Required for virus entry into host cell and for cell-cell fusion (syncytium formation) mint 27C91A3A47DB0A0A p4b_vaccw Major core protein 4b Virion core protein 4b A3L VACWR122 protein protein vaccw vaccinia virus (stra Vaccinia virus (strain WR) VACV MEAVVNSDVFLTSNAGLKSSYTNQTLSLVDEDHIHTSDKSLSCSVCNSLSQIVDDDFISAGARNQRTKPKRAGNNQSQQPIKKDCMVSIDEVASTHDWSTRLRNDGNAIAKYLTTNKYDTSQFTIQDMLNIMNKLNIVRTNRNELFQLLTHVKSTLNNASVSVKCTHPLVLIHSRASPRIGDQLKELDKIYSPSNHHILLSTTRFQSMHFTDMSSSQDLSFIYRKPETNYYIHPILMALFGIKLPALENAYVHGDTYSLIQQLYEFRKVKSYNYMLLVNRLTEDNPIVITGVSDLISTEIQRANMHTMIRKAIMNIIMGIFYCNDDDAVDPHLMKIIHTGCSQVMTDEEQILASILSIVGFRPTLVSVARPINGISYDMKLQAAPYIVVNPMKMITTSDSPISINSKDIYSMAFDGNSGRVVFAPPNIGYGRCSGVTHIDPLGTNVMGSAVHSPVIVNGAMMFYVERRQNKNMFGGECYTGFRSLIDDTPIDVSPEIMLNGIMYRLKSAVCYKLGDQFFDCGSSDIFLKGHYTILFTENGPWMYDLSVFNPGARNARLMRALKNQYKKLSMDSDDGFYEWLNGDGSVFAASKQQMLMNHVANFDDDLLTMEEAMSMISRHCCILIYAQDYDQYISARHITELF mint Precursor for one of the two most abundant structural component of the virion (major core proteins 4a and 4b) 6F073332BAFD0E59 a28-g9 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association F3c homomint mint g9-p4b 2 5 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component colocalization colocalization F3b homomint mint