DIP Database of Interacting Proteins 611 Young Drive East; Los Angeles CA 90095; USA http://dip.doe-mbi.ucla.edu/ dip@mbi.ucla.edu The crystal structure of ORF-9b, a lipid binding protein from the SARS coronavirus. The crystal structure of ORF-9b, a lipid binding protein from the SARS coronavirus. Structure (London, England : 1993) 2006 imex curation Meier C., Aricescu AR., Assenberg R., Aplin RT., Gilbert RJ., Grimes JM., Stuart DI. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dave@strubi.ox.ac.uk Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Meier C., Aricescu AR., Assenberg R., Aplin RT., Gilbert RJ., Grimes JM., Stuart DI. Coronavirus - Interactions investigated in the context of Coronavirus dave@strubi.ox.ac.uk Structure (London, England : 1993) 2006 Only protein-protein interactions imex curation The crystal structure of ORF-9b, a lipid binding protein from the SARS coronavirus. The crystal structure of ORF-9b, a lipid binding protein from the SARS coronavirus. Structure (London, England : 1993) 2006 imex curation Meier C., Aricescu AR., Assenberg R., Aplin RT., Gilbert RJ., Grimes JM., Stuart DI. Virus - Publications including interactions involving viral proteins Coronavirus - Interactions investigated in the context of Coronavirus dave@strubi.ox.ac.uk Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Meier C., Aricescu AR., Assenberg R., Aplin RT., Gilbert RJ., Grimes JM., Stuart DI. Virus - Publications including interactions involving viral proteins dave@strubi.ox.ac.uk Structure (London, England : 1993) 2006 Only protein-protein interactions imex curation orf9b_sars ORF9b protein Protein 9b 9b Accessory protein 9b ORF-9b protein protein sars-cov Human SARS coronavirus SARS-CoV Severe acute respiratory syndrome coronavirus MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 5166F22872915FCB orf9b_cvhsa-6 1 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 2.8Å Rwork - 0.266 Rfree - 0.289 Unspecified Long-chain fatty acid (C25H50O4; mass 413 Da) orf9b_cvhsa-7 2 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. S1 orf9b_cvhsa-orf9b_cvhsa-4 2 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role neutral component neutral component purified purified ecoli Escherichia coli (strain K12) physical association physical association Fig. S1