MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. EMBO J. (0261-4189) 2006 imex curation Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. EMBO J. (0261-4189) 2006 imex curation Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. EMBO J. (0261-4189) 2006 imex curation Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. Phospholipase Cgamma/diacylglycerol-dependent activation of beta2-chimaerin restricts EGF-induced Rac signaling. EMBO J. (0261-4189) 2006 imex curation Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Wang H., Yang C., Leskow FC., Sun J., Canagarajah B., Hurley JH., Kazanietz MG. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation chio_human Beta-chimaerin Beta-chimerin Rho GTPase-activating protein 3 CHN2 ARHGAP3 BCH protein protein human Homo sapiens Human MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF 63254958E0B5804C kpca_human Protein kinase C alpha type PRKCA PKCA PRKACA protein protein human Homo sapiens Human MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV 9EB157789A062349 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 rac1-chn2 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association EMBO-Journal SF2C beta2-Chimaerin also co-immunoprecipitates with an active Rac1 mutant (Supplementary Figure S2C). homomint mint chn2-rac1 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined electron donor electron donor fluorescence donor fluorescence donor over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined electron acceptor electron acceptor fluorescence accept fluorescence acceptor fluorescence accept over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:06:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' 130 range MINT-2490632: original sequence: 130-130 : FESIHDLVTDGLITLYIETK P52757:p.Cys264Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:10:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:02:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys264ala' Tue Jun 30 17:55:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys264Ala' range MINT-2490626: original sequence: 264-264 : KQCSKHVPNDCQPDLKRIKK yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:06:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Ile32Ala range MINT-2490629: original sequence: 32-32 : QPPIWKSYLYQLQQEAPRPK undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:06:59 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' Gln300-302Ala range MINT-2490635: original sequence: 300-302 : RPMVVDICIREIEARGLKSEGL Stoichiometry: 1.0 proximity proximity close-contact colocalization neighbourhood interaction F3 F4 F2B EMBO-Journal PLCgamma1 depletion in COS-7 cells significantly reduced the ability of CFP-Rac1 (wild type) and YFP-beta2-chimaerin (wild type) to associate in response to EGF. When cells coexpressing CFP-Rac1 (wild type) and YFP-beta2-chimaerin (wild type) were subject to EGF treatment, significant FRET was detected in the cell periphery (Figure 2B). Remarkably, under this limiting experimental condition, significant FRET was observed for YFP-fused Q32A- and I130A-beta2-chimaerin mutants (Figure 3D). Remarkably, in cells coexpressing DeltaEIE-beta2-chimaerin and wild-type Rac1, FRET remained high even at longer time points (Figure 4A and B). homomint mint chn2-rac1-1 4 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:19:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Gln264Ala range MINT-2490655: original sequence: 264-264 : KQCSKHVPNDCQPDLKRIKK Stoichiometry: 1.0 colocalization colocalization F5A EMBO-Journal While GFP-beta2-chimaerin did not show a significant degree of colocalization with wild-type Rac1 under serum-free conditions, it colocalized with constitutively active G12V-Rac1 in peripheral ruffles (Figure 5A). homomint mint prkca-rac1 4 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F5B EMBO-Journal While GFP-C1-PKCalpha is localized in the cytoplasm under basal conditions, a significant degree of peripheral colocalization with the activated small G-protein was observed in cells expressing G12V-Rac1 (Figure 5B). homomint mint rac1-chn2-1 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P63000:p.Gly12Val mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G V Tue Jul 12 10:22:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:59:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 18:53:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' range MINT-2490272: original sequence: 12-12 : QAIKCVVVGDGAVGKTCLLI gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P63000:p.Thr17Asn mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Tue Jul 12 10:58:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:19:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 19:01:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' range MINT-2490275: original sequence: 17-17 : VVVGDGAVGKTCLLISYTTN Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association SF2A EMBO-Journal SF2B Beta2-Chimaerin strongly associates with active G12V-Rac1. On the other hand, binding to either the inactive GST-T17N-Rac1 mutant, GST-Rac1 (wild-type) or GST alone was barely detected (Supplementary Figure S2A). Unlike G12V-Rac1, G12V/S189A-Rac1, an activated mutant with impaired geranylgeranylation and membrane targeting, failed to bind to beta2-chimaerin in the pull-down assays (Supplementary Figure S2B). homomint mint