MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. J. Virol. (0022-538X) 2006 Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2006 Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. J. Virol. (0022-538X) 2006 Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2006 Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. J. Virol. (0022-538X) 2006 Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins human-hep2 Homo sapiens hep2 hep2 imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2006 Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. Interaction of the adenovirus type 5 E4 Orf3 protein with promyelocytic leukemia protein isoform II is required for ND10 disruption. J. Virol. (0022-538X) 2006 Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Hoppe A., Beech SJ., Dimmock J., Leppard KN. Virus - Publications including interactions involving viral proteins J. Virol. (0022-538X) 2006 e411_ade05 Probable early E4 11 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MIRCLRLKVEGALEQIFTMAGLNIRDLLRDILRRWRDENYLGMVEGAGMFIEEIHPEGFSLYVHLDVRAVCLLEAIVQHLTNAIICSLAVEFDHATGGERVHLIDLHFEVLDNLLE AE4EF38B8F81EE0A p29590-3 Protein PML MYL PP8675 PML Promyelocytic leukemia protein RING finger protein 71 RNF71 TRIM19 Tripartite motif-containing protein 19 PML-2G PML-IIG TRIM19gamma E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSCMEPMETAEPQSSPAHSSPAHSSPVQSLLRAQGASSLPCGTYHPPAWPPHQPAEQAATPDAEPHSEPPDHQERPAVHRGIRYLLYRAQRAIRLRHALRLHPQLHRAPIRTWSPHVVQASTPAITGPLNHPANAQEHPAQLQRGISPPHRIRGAVRSRSRSLRGSSHLSQWLNNFFALPFSSMASQLDMSSVVGAGESRAQTLGAGVPPGDSVRGSMEASQVQVPLEASPITFPPPCAPERPPISPVPGARQAGL mint Non-canonical splice sites. Might alternatively represent a polymorphic variation. 5DA06243F18A8492 e411-pml 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3B homomint mint e411-e411-1 2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P04489:p.Asn82Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:17:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:17:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn82ala' Tue Jun 30 20:20:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn82Ala' range MINT-3319043: original sequence: 82-82 : LLEAIVQHLTNAIICSLAVE undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:55:00 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 96-100 range MINT-3319049: original sequence: 96-100 : CSLAVEFDHATGGERVHLIDLHFE P04489:p.Leu103Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:17:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:39:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu103ala' Tue Jun 30 18:41:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu103Ala' range MINT-3319046: original sequence: 103-103 : DHATGGERVHLIDLHFEVLD Stoichiometry: 1.0 direct interaction direct interaction F8 homomint mint pml-e411 4 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell P04489:p.Glu10Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:17:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:34:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu10ala' Tue Jun 30 15:38:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu10Ala' range MINT-2983493: original sequence: 10-10 : MIRCLRLKVEGALEQIFTM P04489:p.Cys4Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C A Tue Jul 12 10:55:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:46:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys4ala' Tue Jun 30 18:10:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys4Ala' range MINT-2983490: original sequence: 4-4 : MIRCLRLKVEGAL undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:53:01 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 38-42 range MINT-2793781: original sequence: 38-42 : LRDILRRWRDENYLGMVEGAGMFI undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:52:56 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Thr35Ala range MINT-2983499: original sequence: 35-35 : RDLLRDILRRWRDENYLGMV undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:52:56 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 96-100 range MINT-2793784: original sequence: 96-100 : CSLAVEFDHATGGERVHLIDLHFE P04489:p.Asn82Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:14:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:31:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn82ala' Tue Jun 30 16:54:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn82Ala' range MINT-2793787: original sequence: 82-82 : LLEAIVQHLTNAIICSLAVE P04489:p.Glu74Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:14:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:01:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu74ala' Tue Jun 30 17:10:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu74Ala' range MINT-2983496: original sequence: 74-74 : HLDVRAVCLLEAIVQHLTNA undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:06 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Asn103Ala range MINT-2793790: original sequence: 103-103 : DHATGGERVHLIDLHFEVLD undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:22 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' Gly97-98Ala range MINT-2983502: original sequence: 97-98 : SLAVEFDHATGGERVHLIDLH Stoichiometry: 1.0 physical association physical association F5C F2C homomint mint e411-pml-1 3 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell Stoichiometry: 1.0 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:43 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 38-42 range MINT-2793805: original sequence: 38-42 : LRDILRRWRDENYLGMVEGAGMFI undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:09:42 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 96-100 range MINT-2793802: original sequence: 96-100 : CSLAVEFDHATGGERVHLIDLHFE P04489:p.Asn82Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain N A Tue Jul 12 10:15:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:24:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn82ala' Tue Jun 30 19:53:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn82Ala' range MINT-2793799: original sequence: 82-82 : LLEAIVQHLTNAIICSLAVE P04489:p.Leu103Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:15:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:06:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu103ala' Tue Jun 30 18:09:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu103Ala' range MINT-2793796: original sequence: 103-103 : DHATGGERVHLIDLHFEVLD Stoichiometry: 1.0 colocalization colocalization F6 homomint mint e411-pml-2 1 6 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Stoichiometry: 1.0 colocalization colocalization F7 homomint mint