MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it 14-3-3 proteins integrate E2F activity with the DNA damage response. 14-3-3 proteins integrate E2F activity with the DNA damage response. EMBO J. (0261-4189) 2006 imex curation Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins integrate E2F activity with the DNA damage response. 14-3-3 proteins integrate E2F activity with the DNA damage response. EMBO J. (0261-4189) 2006 imex curation Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins integrate E2F activity with the DNA damage response. 14-3-3 proteins integrate E2F activity with the DNA damage response. EMBO J. (0261-4189) 2006 imex curation Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins integrate E2F activity with the DNA damage response. 14-3-3 proteins integrate E2F activity with the DNA damage response. EMBO J. (0261-4189) 2006 imex curation Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions human-ml-1 Human myeloblastic leukemia ML-1 cell line ml-1 Myeloblastic leukemia ML-1 cell line anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins integrate E2F activity with the DNA damage response. 14-3-3 proteins integrate E2F activity with the DNA damage response. EMBO J. (0261-4189) 2006 imex curation Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation 14-3-3 proteins integrate E2F activity with the DNA damage response. 14-3-3 proteins integrate E2F activity with the DNA damage response. EMBO J. (0261-4189) 2006 imex curation Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Milton AH., Khaire N., Ingram L., O'Donnell AJ., La Thangue NB. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation tfdp2_human Transcription factor Dp-2 E2F dimerization partner 2 TFDP2 DP2 protein protein human Homo sapiens Human MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGPQMIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIINTSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYITDISTGPSWLNQGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCSESRGETPCSFNDEDEEDDEEDSSSPE 19A6C85BAD61DFF1 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ DIP protein P62258 original sequence version: 130 DIP protein P62258 original sequence version: 132 DIP protein P62258 original sequence version: 91 07817CCBD1F75B26 e2f5_mouse Transcription factor E2F5 E2f5 protein protein mouse Mus musculus Mouse MAAAEPTSSAQPTPQAQAQPPPHGAPSSQPSAALAGGSSRHEKSLGLLTTKFVSLLQEAQDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRCLKAEIEDLELKERELDQQKLWLQQSIKNVMEDSINNRFSYVTHEDICNCFHGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY mint Transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. May mediate growth factor-initiated signal transduction 7922ACE79C73944B q64163-4 Transcription factor Dp-2 Tfdp2 Dp-3 Dp2 E2F dimerization partner 2 protein protein mouse Mus musculus Mouse MIISTPQRIANSGSVLIGNPYTPAPAMVTQTHIAEAAGWVPSDRKRAREFIDSDFSESKRSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQENIRRRVYDALNVLMAMNIISSLPTGKKRNQVDCNSAQECQNLEIEKQRRIERIKQKRAQLQELLLQQIAFKNLVQRNRQNEQQNQGPPAVNSTIQLPFIIINTSRKTVIDCSISSDKFEYLFNFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKIARSLVPKALEGYITDISTGPSWLNQGLLLNSTQSVSNLDPTTGATVPQSSVNQGLCLDAEVALATGQLPASNSHQSSSAASHFSESRGETPCSFNDEDEEDEEEDPSSPE mint C76E95880BB3582E 1433e_mouse 14-3-3 protein epsilon Ywhae protein protein mouse Mus musculus Mouse MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ 07817CCBD1F75B26 tfdp2-ywhae 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q64163-4:p.Ser56Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:19:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:09:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser56ala' Tue Jun 30 17:46:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser56Ala' range MINT-1784708: original sequence: 56-56 : RAREFIDSDFSESKRSKKGD Q64163-4:p.Ser61Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:19:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:19:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser61ala' Tue Jun 30 19:39:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser61Ala' range MINT-1784712: original sequence: 61-61 : IDSDFSESKRSKKGDKNGKG Q64163-4:p.Ser42Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:19:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:20:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser42ala' Tue Jun 30 19:22:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser42Ala' range MINT-1784704: original sequence: 42-42 : HIAEAAGWVPSDRKRAREFI Q64163-4:p.Ser53Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:56:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53ala' Tue Jun 30 17:48:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Ala' range MINT-1784706: original sequence: 53-53 : DRKRAREFIDSDFSESKRSK Q64163-4:p.Ser58Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:19:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:22:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58ala' Tue Jun 30 16:22:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser58Ala' range MINT-1784710: original sequence: 58-58 : REFIDSDFSESKRSKKGDKN gst tagged gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3B EMBO-Journal he DP-3 5S mutant, where five serine residues in DP-3delta had been changed to alanine (Figure 2B), failed to interact with 14-3-3alt epsilon, in contrast to the other mutant derivatives 2S, 3S and 4S, which retained binding activity (Figure 3B, and data not shown). mint tfdp2-e2f5 2 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3B EMBO-Journal Thus, DP-3 5S bound to an E2F partner (Figure 3B), mint tfdp2-ywhae-1 1 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2D EMBO-Journal The interaction was tested in mammalian U2OS cells using the two-hybrid assay with VP16-tagged 14-3-3alt epsilon and Gal4-DNA-binding domain-tagged DP-3delta or DP-1 where significant stimulation of activity was apparent when VP16-14-3-3alt epsilon was co-expressed with Gal4-DP-3delta but not with Gal4-DP-1 (Figure 2D). mint tfdp2-ywhae-2 6 10 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q64163-4:p.Ser58Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:16:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:53:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58ala' Tue Jun 30 18:40:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser58Ala' range MINT-1784770: original sequence: 58-58 : REFIDSDFSESKRSKKGDKN Q64163-4:p.Ser56Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:16:19 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:05:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser56ala' Tue Jun 30 17:24:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser56Ala' range MINT-1784772: original sequence: 56-56 : RAREFIDSDFSESKRSKKGD Q64163-4:p.Ser42Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:16:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:38:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser42ala' Tue Jun 30 20:05:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser42Ala' range MINT-1784776: original sequence: 42-42 : HIAEAAGWVPSDRKRAREFI Q64163-4:p.Ser61Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:54:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:21:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser61ala' Tue Jun 30 18:25:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser61Ala' range MINT-1784768: original sequence: 61-61 : IDSDFSESKRSKKGDKNGKG Q64163-4:p.Ser53Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:13:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:16:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53ala' Tue Jun 30 18:24:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Ala' range MINT-1784774: original sequence: 53-53 : DRKRAREFIDSDFSESKRSK Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3C F3D EMBO-Journal We next studied the interaction between DP-3delta and 14-3-3alt epsilon in cells. By immunoprecipitation followed by immunoblotting, DP-3delta and 14-3-3alt epsilon bound specifically to each other, and the interaction was not altered by the presence of the E2F subunit (Figure 3C). A similar level of specificity was apparent when antibodies against either DP-3delta or 14-3-3alt epsilon were used in the primary immunoprecipitation step (Figure 3C E). mint ywhae-tfdp2 6 10 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Q64163-4:p.Ser42Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:53:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:15:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser42ala' Tue Jun 30 18:21:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser42Ala' range MINT-1784887: original sequence: 42-42 : HIAEAAGWVPSDRKRAREFI Q64163-4:p.Ser53Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:14:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:58:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53ala' Tue Jun 30 16:59:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Ala' range MINT-1784885: original sequence: 53-53 : DRKRAREFIDSDFSESKRSK Q64163-4:p.Ser56Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:53:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:42:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser56ala' Tue Jun 30 17:16:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser56Ala' range MINT-1784883: original sequence: 56-56 : RAREFIDSDFSESKRSKKGD Q64163-4:p.Ser61Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:53:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:27:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser61ala' Tue Jun 30 18:10:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser61Ala' range MINT-1784879: original sequence: 61-61 : IDSDFSESKRSKKGDKNGKG Q64163-4:p.Ser58Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:53:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:19:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58ala' Wed May 02 18:29:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58ala' Tue Jun 30 16:14:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser58Ala' range MINT-1784881: original sequence: 58-58 : REFIDSDFSESKRSKKGDKN Stoichiometry: 1.0 11 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3E EMBO-Journal The DP-3 5S mutant, where five serine residues in DP-3delta had been changed to alanine (Figure 2B), failed to interact with 14-3-3alt epsilon, in contrast to the other mutant derivatives 2S, 3S and 4S, which retained binding activity (Figure 3B, and data not shown). Similarly, in cells there was very reduced binding to 14-3-3alt epsilon (Figure 3D and E), suggesting that DP-3 5S is a mutant derivative devoid of 14-3-3alt epsilon binding activity. mint tfdp2-e2f5-1 6 10 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 9 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3C EMBO-Journal DP-3delta and 14-3-3alt epsilon bound specifically to each other, and the interaction was not altered by the presence of the E2F subunit (Figure 3C). mint tfdp2-ywhae-3 3 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tagged molecule tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F2C EMBO-Journal the specificity of the interaction was assessed in yeast where the interaction between 14-3-3alt epsilon and DP-3 was found to be dependent upon the presence of both the E and B region, since the natural DP-3beta isoform (which lacks the E region) and the DP-3DeltaB mutant derivative (lacking the stretch of basic residues) failed to interact (Figure 2B and C). It is consistent with this idea that DP-1, which lacks sequence that exhibits similarity to the E region (Ormondroyd et al, 1995), also failed to interact with 14-3-3alt epsilon (Figure 2C). mint ywhae-tfdp2-1 4 8 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 7 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F3G EMBO-Journal Most importantly, we established that 14-3-3alt epsilon and DP-3 interact under physiological conditions by immunoprecipitating 14-3-3alt epsilon from ML-1 cells, where human DP-2 (the human equivalent of murine DP-3) was specifically detected in the immunocomplex (Figure 3G). Thus, DP-3 and 14-3-3alt epsilon interact under physiological conditions. homomint mint tfdp2-ywhae-4 5 10 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell Q64163-4:p.Ser61Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:17:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:06:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser61ala' Tue Jun 30 18:40:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser61Ala' range MINT-1784918: original sequence: 61-61 : IDSDFSESKRSKKGDKNGKG Q64163-4:p.Ser53Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:17:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:53:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser53ala' Tue Jun 30 16:51:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser53Ala' range MINT-1784924: original sequence: 53-53 : DRKRAREFIDSDFSESKRSK Q64163-4:p.Ser58Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:17:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:03:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser58ala' Tue Jun 30 18:37:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser58Ala' range MINT-1784920: original sequence: 58-58 : REFIDSDFSESKRSKKGDKN Q64163-4:p.Ser56Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:55:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:26:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser56ala' Tue Jun 30 18:14:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser56Ala' range MINT-1784922: original sequence: 56-56 : RAREFIDSDFSESKRSKKGD Q64163-4:p.Ser42Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:17:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:28:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser42ala' Tue Jun 30 15:52:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser42Ala' range MINT-1784926: original sequence: 42-42 : HIAEAAGWVPSDRKRAREFI Stoichiometry: 1.0 11 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell myc tagged myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 colocalization colocalization F6 EMBO-Journal Figure 6:Intracellular location of 14-3-3alt epsilon and DP-3delta. mint