MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A unique set of SH3-SH3 interactions controls IB1 homodimerization. A unique set of SH3-SH3 interactions controls IB1 homodimerization. EMBO J. (0261-4189) 2006 imex curation Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk 2009-01-08 Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation A unique set of SH3-SH3 interactions controls IB1 homodimerization. A unique set of SH3-SH3 interactions controls IB1 homodimerization. EMBO J. (0261-4189) 2006 imex curation Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation A unique set of SH3-SH3 interactions controls IB1 homodimerization. A unique set of SH3-SH3 interactions controls IB1 homodimerization. EMBO J. (0261-4189) 2006 imex curation Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk 2009-01-08 Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation A unique set of SH3-SH3 interactions controls IB1 homodimerization. A unique set of SH3-SH3 interactions controls IB1 homodimerization. EMBO J. (0261-4189) 2006 imex curation Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk 2009-01-08 Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation A unique set of SH3-SH3 interactions controls IB1 homodimerization. A unique set of SH3-SH3 interactions controls IB1 homodimerization. EMBO J. (0261-4189) 2006 imex curation Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk 2009-01-08 Only protein-protein interactions in vitro In vitro light scattering light scattering nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation A unique set of SH3-SH3 interactions controls IB1 homodimerization. A unique set of SH3-SH3 interactions controls IB1 homodimerization. EMBO J. (0261-4189) 2006 imex curation Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Kristensen O., Guenat S., Dar I., Allaman-Pillet N., Abderrahmani A., Ferdaoussi M., Roduit R., Maurer F., Beckmann JS., Kastrup JS., Gajhede M., Bonny C. Virus - Publications including interactions involving viral proteins SH3 ok@dfuni.dk EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation q9r237-3 C-Jun-amino-terminal kinase-interacting protein 1 Mapk8ip1 Ib1 Islet-brain-1 JIP-1-related protein JNK MAP kinase scaffold protein 1 Jip1 Mapk8ip Mitogen-activated protein kinase 8-interacting protein 1 JIP-1d protein protein rat Rattus norvegicus (Rat) Rat MAERESGLSGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRMDLIDAASDTPGAEDDEEDDDELAAQRPGVGPSKAESGQEPASRSQGQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRTAATQMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFLPPTESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPEQAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADEAQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLEPMAQVQLQVDLEIKRAAAEQKLISEEDLNGAA mint 21DFC770F875277B mp2k7_human Dual specificity mitogen-activated protein kinase kinase 7 MAPK/ERK kinase 7 JNK-activating kinase 2 c-Jun N-terminal kinase kinase 2 MAP2K7 JNKK2 MKK7 PRKMK7 MEK7 Stress-activated protein kinase kinase 4 SKK4 protein protein human Homo sapiens Human MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR F1B22E050F54299A mk08_human Mitogen-activated protein kinase 8 MAPK8 JNK1 PRKM8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 JNK-46 SAPK1 Stress-activated protein kinase 1c SAPK1C protein protein human Homo sapiens Human MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR DIP protein P45983 original sequence version: 96 DIP protein P45983 original sequence version: 185 DIP protein P45983 original sequence version: 124 DIP protein P45983 original sequence version: 103 94FB6BE0358B9B60 jip2_rat C-Jun-amino-terminal kinase-interacting protein 2 Mapk8ip2 Ib2 Islet-brain-2 JNK MAP kinase scaffold protein 2 Jip2 Mitogen-activated protein kinase 8-interacting protein 2 protein protein rat Rattus norvegicus (Rat) Rat MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSLSLGRSEQPHPICSFQDDFQEFEMIDDNEEEEDEEEEEEEEEEEDGDGDGRAGGGSGSQELSGESLIPSPSIEESHKLRPTTLHLTTLGAQDSLNNNSNGGFTSAPPSSWQETVLRSPVQEPLKELPAPLLPAEEEHHEVQSLARPGCDCEGNQPPEPPASGGASPSSDPGIEADLRSHSSGGHEGRRSSQELSSPGSDSEEAGGARLGRMISSISETELELSSDSGSSSGRSSHLTNSIEEASSPASEPEPEPEPEPLHEPPRRPAFLPVGQDDTNSEYESGSESEPDLSEDADSPWLLSNLVSRMISEGSSPIRCPGQCLSPPAPRPPEEAASQANPVPQDCPDPEAVAGPHVELVDMDTLCGPPPPAPAAPRLGPAQSGPCLFLSNPTRDTITPLWAPPGRTARPGRSCSAACSEEEEEDEEEDEEDEEDAEDSVIPPGSRTTGSTAPLDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLDNDSEEDSSCEASEEEAGATLLGSDQVPEDASPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCVVNGEEREQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFPAFYAHAVPGPAKDLLGSKRSPCWVDRFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPASCDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLSRFACHVFVSQESMRPVARSVGRAFLEYYQEHLAFACPTEDIYLE fragmentation type: fragment mint D88871BA1FFB4398 m3k11_human Mitogen-activated protein kinase kinase kinase 11 MAP3K11 Mixed lineage kinase 3 Src-homology 3 domain-containing proline-rich kinase SPRK PTK1 MLK3 protein protein human Homo sapiens Human MEPLKSLFLKSPLGSWNGSGSGGGGGGGGGRPEGSPKAAGYANPVWTALFDYEPSGQDELALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRLEEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTFSKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCWAQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLSREEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFKRSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGPGDSPTFPRFRAIQLEPAEPGQAWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSPLGSPSTPPALNGNPPRPSLEPEEPKRPVPAERGSSSGTPKLIQRALLRGTALLASLGLGRDLQPPGGPGRERGESPTTPPTPTPAPCPTEPPPSPLICFSLKTPDSPPTPAPLLLDLGIPVGQRSAKSPRREEEPRGGTVSPPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP AFB6E930EA281C15 mapk8ip1-mapk8ip1 2 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836515: original sequence: 489-599 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADE Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836501: original sequence: 489-559 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVL gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:45:43 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg506Ala range MINT-2836504: original sequence: 506-506 : YWYEAYNMRTGARGVFPAYY Stoichiometry: 1.0 physical association physical association F2A F2D F5A EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip2-mapk8ip1 2 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836539: original sequence: 327-377 : QTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGERGVFP Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F2A EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-1 4 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836620: original sequence: 489-559 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVL undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:26 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' His507Asp range MINT-2836627: original sequence: 507-507 : WYEAYNMRTGARGVFPAYYA undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:11 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg506Glu range MINT-2836624: original sequence: 506-506 : YWYEAYNMRTGARGVFPAYY his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836578: original sequence: 489-559 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVL undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:17 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' His507Asp range MINT-2836635: original sequence: 507-507 : WYEAYNMRTGARGVFPAYYA his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg506Glu range MINT-2836631: original sequence: 506-506 : YWYEAYNMRTGARGVFPAYY Stoichiometry: 1.0 direct interaction direct interaction EMBO-Journal SF1A IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-2 5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836650: original sequence: 489-559 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVL Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836666: original sequence: 489-559 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVL Stoichiometry: 1.0 direct interaction direct interaction EMBO-Journal SF1C IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-3 3 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836685: original sequence: 494-553 : EDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYH Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836699: original sequence: 494-553 : EDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYH Stoichiometry: 1.0 direct interaction direct interaction F3 EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-4 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:59:45 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg506Ala range MINT-2836739: original sequence: 506-506 : YWYEAYNMRTGARGVFPAYY binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2836723: original sequence: 489-559 : VELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVL Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B F2E EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-5 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:59:37 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Tyr546Ala range MINT-2836748: original sequence: 546-546 : IDQFRVKFLGSVQVPYHKGN Stoichiometry: 1.0 physical association physical association F5C EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-6 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:57:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Arg506Ala range MINT-2836777: original sequence: 506-506 : YWYEAYNMRTGARGVFPAYY gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:57:47 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' His507Asp range MINT-2836796: original sequence: 507-507 : WYEAYNMRTGARGVFPAYYA Stoichiometry: 1.0 physical association physical association F5C EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-mapk8ip1-7 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:57:34 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' 466-715 range MINT-2836824: original sequence: 466-715 : RAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADEAQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLEPMAQVQLQVDLEIKRAAAEQKLISEEDLNGA Stoichiometry: 1.0 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F5B F5C EMBO-Journal IB1 oligomerization is mediated by its own SH3 domain homomint mint mapk8ip1-map3k11 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 11 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell Stoichiometry: 1.0 physical association physical association F6C EMBO-Journal JNK, MKK7 and MLK3, appear to bind to the IB1 homomint mint mapk8ip1-mapk8-8 6 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 9 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 physical association physical association F6C EMBO-Journal JNK, MKK7 and MLK3, appear to bind to the IB1 homomint mint mapk8ip1-map2k7 1 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 8 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated Stoichiometry: 1.0 physical association physical association F6C EMBO-Journal JNK, MKK7 and MLK3, appear to bind to the IB1 homomint mint