MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Transferrin receptor-like proteins control the degradation of a yeast metal transporter. Transferrin receptor-like proteins control the degradation of a yeast metal transporter. EMBO J. (0261-4189) 2006 imex curation Stimpson HE., Lewis MJ., Pelham HR. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Stimpson HE., Lewis MJ., Pelham HR. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Transferrin receptor-like proteins control the degradation of a yeast metal transporter. Transferrin receptor-like proteins control the degradation of a yeast metal transporter. EMBO J. (0261-4189) 2006 imex curation Stimpson HE., Lewis MJ., Pelham HR. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast pull down pull down nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Stimpson HE., Lewis MJ., Pelham HR. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation Transferrin receptor-like proteins control the degradation of a yeast metal transporter. Transferrin receptor-like proteins control the degradation of a yeast metal transporter. EMBO J. (0261-4189) 2006 imex curation Stimpson HE., Lewis MJ., Pelham HR. Virus - Publications including interactions involving viral proteins 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Stimpson HE., Lewis MJ., Pelham HR. Virus - Publications including interactions involving viral proteins EMBO J. (0261-4189) 2006 2009-01-08 Only protein-protein interactions imex curation rsp5_yeast E3 ubiquitin-protein ligase RSP5 RSP5 MDP1 NPI1 YER125W SYGP-ORF41 Reverses SPT-phenotype protein 5 HECT-type E3 ubiquitin transferase RSP5 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSSISVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAKKTLNPYWNETFKFDDINENSILTIQVFDQKKFKKKDQGFLGVVNVRVGDVLGHLDEDTATSSGRPREETITRDLKKSNDGMAVSGRLIVVLSKLPSSSPHSQAPSGHTASSSTNTSSTTRTNGHSTSSTRNHSTSHPSRGTAQAVESTLQSGTTAATNTATTSHRSTNSTSSATRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTEAERGNQLNANTELERRQHRGRTLPGGSSDNSSVTVQVGGGSNIPPVNGAAAAAFAATGGTTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGVDAEVYNSLNWMLENSIDGVLDLTFSADDERFGEVVTVDLKPDGRNIEVTDGNKKEYVELYTQWRIVDRVQEQFKAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVQQLPKSHTCFNRVDLPQYVDYDSMKQKLTLAVEETIGFGQE 6F1836384479E70F 6F1836384479E70F bsd2_yeast Metal homeostatis protein BSD2 BSD2 YBR290W YBR2037 Bypass SOD defects protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPEQELLIGQEMNTLHAGSSTDGINVGNAGRTRDTQTGVEGETEIGSDEEDSIEDEGSSSGGNSTTERLVPHQLREQAARHIGKIGRHFNILDRLFKKRTQQSSDIQQGAMFDGVFSNLSAKPDTTETEGNNEQDIPPTYDEAAADMAPSYYGMDLNNSDIYYDEICIEGLPVGNIANLLWNIIVSTSFQFIGFLITYILHTSHAAKQGSRFGLGLTFIGYGYSMIPNDVTSKVGKNKSLNRMELEDPNEFDDVRLNSQSTTQDKFESHLNHGLDEEKQNIPWLAVFVAFLGLFITLKSIYDYIQVKKLEKKYLNQSQNQA 1C212AED2A249850 tre1_yeast Uncharacterized protein TRE1 Transferrin receptor-like protein 1 TRE1 YPL176C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNTRGYTTLPNVEEPANNSQDELNSQDFEQAIGMPSEPPVYVEEMGMEEPQAPEAFSEKVQRFRMCFENNVVIPVKKNVVDPLAQMISLASEKFDLFLSKIGNVMVMRRIFYIMMMSIIAALIIASDRLPNGKARGSNGSFSDHDLLLQYARKSIDLSKIERDLEYISSMPHMSGTSGDAAIRHYIKESFDKNGIRLAGEEEFMAYSNYPGNVSLRVYSKDDTEGFDIPLNEENFNPMSHNGQLNNIPVIYANKASLDDMASMQDQGLLNGDFILLVHYGDYVFQQMLTAQEYGAKAIIFISEPYQDNKDVIQMKSVALPQYGTGDALTPEWEGSIRDPIDATEAKCLPKIPSIPISANQGDKILAILSDTGVKFSNNLFSGSLNDCRLDLLVQTAIRERHPVHDIVGKIEGSEQAGRAIVIAAPRNSASYGTMYPSFGTVVLLSLIQLYQEMVYKFDWKPLRNIYFISFGGSEFNEAGATELMEKRTEALKSEIYTIIDVGQIGIWDDSNNLEIQCHPLLVDLFQKNMTSRKFNVKVDNVHQFGDWTPYLAQGIPVAIISSPGVMNREHPIYTVEDKFDFIKDKLRDKKKGEVLSEIMLYLVEKSLELIDDPFIPFSISNYVDFLSTTLKDLQKECPDTVNFDEVFLGTTLWENTKLQFEKWKSEWTELMYGAGTYIEPTIIAINRWSWNYLLSLIGVTQCLEEGLMDRTFYKNVIFGPKLWVDKGDPLRSWTFPEIRDTIAIKDWSSVQVQANTLGTILQNTARYFLENKNLHGINTNEF 85D78D5D2FE114A7 ubi4p_yeast Polyubiquitin UBI4 SCD2 YLL039C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGN Protein modifier which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Attachment to proteins as a Lys-48-linked polymer usually leads to their degradation by proteasome. Attachment to proteins as a monomer or as an alternatively linked polymer does not lead to proteasomal degradation and may be required for numerous functions, including maintenance of chromatin structure, regulation of gene expression, stress response, ribosome biogenesis and DNA repair mint 68C6235F9909A2AE rsp5-tre1 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q08919:p.Tyr42Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y G Tue Jul 12 10:14:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:19:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr42gly' Tue Jun 30 19:45:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr42Gly' range MINT-2835711: original sequence: 42-42 : AIGMPSEPPVYVEEMGMEEP binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cytoplasmic region range MINT-2834737: original sequence: 1-109 : MVNTRGYTTLPNVEEPANNSQDELNSQDFEQAIGMPSEPPVYVEEMGMEEPQAPEAFSEKVQRFRMCFENNVVIPVKKNVVDPLAQMISLASEKFDLFLSKIGNVMVM Q08919:p.Val41Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:14:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:07:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val41ala' Tue Jun 30 18:10:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val41Ala' range MINT-2834728: original sequence: 41-41 : QAIGMPSEPPVYVEEMGMEE Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2834717: original sequence: 221-273 : YSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLDQTEAERGNQ Stoichiometry: 1.0 physical association physical association F3A EMBO-Journal il dominio citoplasmatico di tre l\'ho pricavato io il costrutto non è descritto Tre1 PPXY motif can bind the ww domains of Rsp5 mint rsp5-tre1-1 1 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2834757: original sequence: 382-428 : PVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQN gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate Q08919:p.Val41Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:20:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:11:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val41ala' Tue Jun 30 16:40:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val41Ala' range MINT-2834743: original sequence: 41-41 : QAIGMPSEPPVYVEEMGMEE Q08919:p.Tyr42Gly mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y G Tue Jul 12 10:20:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:09:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr42gly' Tue Jun 30 20:25:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr42Gly' range MINT-2835719: original sequence: 42-42 : AIGMPSEPPVYVEEMGMEEP tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cytoplasmic region range MINT-2834746: original sequence: 1-109 : MVNTRGYTTLPNVEEPANNSQDELNSQDFEQAIGMPSEPPVYVEEMGMEEPQAPEAFSEKVQRFRMCFENNVVIPVKKNVVDPLAQMISLASEKFDLFLSKIGNVMVM Stoichiometry: 1.0 physical association physical association F3A EMBO-Journal il dominio citoplasmatico di tre l\'ho pricavato io il costrutto non è descritto Tre1 PPXY motif can bind the ww domains of Rsp5 mint rsp5-tre1-2 1 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:57:14 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Trp41Ala range MINT-2834790: original sequence: 41-41 : QAIGMPSEPPVYVEEMGMEE binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cytoplasmic region range MINT-2834787: original sequence: 1-109 : MVNTRGYTTLPNVEEPANNSQDELNSQDFEQAIGMPSEPPVYVEEMGMEEPQAPEAFSEKVQRFRMCFENNVVIPVKKNVVDPLAQMISLASEKFDLFLSKIGNVMVM Q08919:p.Tyr42Gly mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y G Tue Jul 12 10:18:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:50:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr42gly' Tue Jun 30 17:19:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr42Gly' range MINT-2835715: original sequence: 42-42 : AIGMPSEPPVYVEEMGMEEP Stoichiometry: 1.0 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-2834770: original sequence: 324-372 : GGTTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTY gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3A EMBO-Journal il dominio citoplasmatico di tre l\'ho pricavato io il costrutto non è descritto Tre1 PPXY motif can bind the ww domains of Rsp5 mint tre1-ubi4 3 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level Stoichiometry: 1.0 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3B EMBO-Journal Tre1 does indeed undergo ubiquitination mint tre1-bsd2 2 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Stoichiometry: 1.0 physical association physical association F3C EMBO-Journal Tre1 binds Bsd2 in vivo mint